CAZyme Information: MGYG000004573_01062

Basic Information

• Species: F082 sp002633315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp002633315
• CAZyme ID: MGYG000004573_01062
• CAZy Family: GT83
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		60856.14	9.4169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004573	2473880	MAG	France	Europe

• Gene Location: Start: 4354; End: 5922 Strand: -

Full Sequence      

MVLNDNKIKKYLLWLLVISTVIRAFLAAFFEFGNDEVYYWTYALYPDWSHFDHPPMVGWV
MQLFSLNLLFSDEFFLRLASVVFMTIDTWLFYRIGKEIKDSLTGFYAALLFTASLYGFVI
IGVFILPDTPLMLFMLLSLLSFIRYFKTSKNKYMLLGGLFAGLSLLSKYSAVFIWSGVGL
YILLFDRKQLKNKYLYLSALISVVCLLPVLIWNIQNDFISFTFHGDRVSFFDKLRPKYFL
TELVGEFLYNNPVNFVMIIIALVLMARGKRVLNGRDVRLLLTTCIPFIAVFWFFSLTRPI
LPHWTAPALSIMLLFPAAVFAEKHKNKQKRPVPVGIKLSLSLLLIIVAVGGAEIKTGFVS
LRFTERSETVQRYGESDFTLSMYGWKKIRTQFESIRNQKIEQGMMKESDAMINLNWYPCA
NLDYYVAYPLGMKMLAYGEPVMIHKYLWINEYRGGFKKGDDYWFLTESCDYYDVNRYFKD
CFSEMIPCDTITVERCGKPAKYVFVYMLKDLKKVPDVNTMIK

Enzyme Prediction     

No EC number prediction in MGYG000004573_01062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	9	350	6.6e-47	0.65

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13231	PMT_2	2.23e-22	52	212	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1807	ArnT	5.33e-19	7	314	5	330	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG1928	PMT1	1.66e-07	7	253	19	299	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1287	Stt3	1.94e-05	7	320	17	385	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	0.004	72	216	81	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APW64005.1	2.19e-38	9	503	4	487
AMV37147.1	6.95e-37	9	510	4	492
QEH37059.1	3.32e-36	9	510	4	494
AGA29189.1	5.20e-33	13	316	7	319
SDS45108.1	4.11e-29	3	323	4	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34
74	92
104	126
163	185
194	216
243	265
277	296
300	319
332	354