CAZyme Information: MGYG000004573_00087

Basic Information

• Species: F082 sp002633315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp002633315
• CAZyme ID: MGYG000004573_00087
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004573_1|CGC2	43188.95	10.3233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004573	2473880	MAG	France	Europe

• Gene Location: Start: 95551; End: 96675 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGSNLVAALKRRDPNAVIRAWGGNLMRKKGAEIVKHYKDLAFMGFV
EVLFHLKTILKNFNFCKKDIKQFAPDAVILIDYPGFNIKMAKYVRKLGIKVFYYISPQVW
AWKRRRVFTIKKTVDKMLVILPFEKDFYDSYNVDSVFVGHPLLDEMYSMKHVDRQVFYKQ
NRLNPKKEIIAMLPGSRKQEVAKMLHVMLEVVKKFPDYQFVVACAPSLPVSYYKSLIGKA
NVRFVVNRTYQLLQVSSAAMVTSGTATLETALLDVPQVVCYKGSRISYIIAKNLIKVKYI
SLVNLIMNKPVVKELIQDDLTADNIKNELNQLLRNPKRQKRLLEDYDELKYRLGNEGASD
RAANIIVQNIYRPR

Enzyme Prediction     

No EC number prediction in MGYG000004573_00087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	9.6e-131	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.21e-141	1	368	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.36e-124	1	368	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.67e-93	4	363	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.06e-86	5	363	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.14e-68	52	366	46	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQY21587.1	9.52e-157	1	369	1	366
QZO96620.1	1.92e-156	1	368	1	365
QZO87056.1	1.92e-156	1	368	1	365
AZZ59290.1	1.92e-156	1	368	1	365
QYR05999.1	1.92e-156	1	368	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.05e-50	5	368	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.87e-50	5	368	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	4.14e-83	5	363	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	6.76e-82	2	368	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	5.36e-81	2	374	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	2.94e-75	5	371	8	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	4.15e-75	5	371	8	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004573_00087.