CAZyme Information: MGYG000004561_02119

Basic Information

• Species: Prevotella sp002480935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002480935
• CAZyme ID: MGYG000004561_02119
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000004561_56|CGC1	29995.13	7.6948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004561	3001921	MAG	France	Europe

• Gene Location: Start: 10809; End: 11573 Strand: +

Full Sequence      

MIPKKIHFVWLGKGKYTPSVRRCIDSWKRCMPDFEIKCWNEDNFDLDSVTWVKEAISKKK
WSLASDYIRHYAIYTEGGIYMDTDVLTFKSFTPFLKYDFFTAVEHHPKIYTAENQNKIKS
DGMPERPDEPVKGFALLASCFGASKGNPYIKECMDFFGERHYIREDGSLFEDIINPDIMA
MLLTKRGFRYRDENQMLDNNFAVFNSSVFASEDTRNKDSFAVHWCDNSWTTDRLNWKGKL
AAYARTHFFYLFRH

Enzyme Prediction     

No EC number prediction in MGYG000004561_02119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	5.7e-21	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.43e-12	1	131	81	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.54e-12	20	100	4	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.01e-04	1	101	45	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.92e-04	4	43	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.003	60	125	167	228	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII62444.1	6.26e-107	1	253	1	252
QQR19333.1	2.87e-103	2	239	7	249
ANU59797.1	2.87e-103	2	239	7	249
QUT47110.1	3.17e-99	2	248	3	248
AFL77721.1	2.88e-93	11	239	2	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004561_02119.