CAZyme Information: MGYG000004561_01044

Basic Information

• Species: Prevotella sp002480935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002480935
• CAZyme ID: MGYG000004561_01044
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1094	MGYG000004561_15|CGC1	124680.68	7.9321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004561	3001921	MAG	France	Europe

• Gene Location: Start: 34130; End: 37414 Strand: -

Full Sequence      

MRKFITLIILLTVTVWVEGRQIIPLNDGWSYRPISNLNVKDIPVTLPHTWNAKYVDSTYY
NRETMVYHRSLDITPQMKGKRLFLYFEGCNSVADVFINRQTVGQHKGGYTSFCLEITDYV
KRGNNELEVWVSNAFRTDVLPISGDFNIYGGIHRPCHLLITEQDCISPLFYASPGVLIHQ
DNVTENAAELTVETLLSLKSAKKNLRLKTSIMDATGKIISSHESVVNSENVRQPFKIPHP
ILWNGRANPYLYTIMVELYDGKNLLDAVDEQTGFRYFYVDADKGFFLNGKPYNLRGFNRH
EDIEGKGSALTKEDYNHDMSLIMESGATMLRLVHYPHAEPIYNLCDKMGIVVWSEIPLCG
PGGYDFTGYLHQTGLEDNARQVALEMVYQKFNHPSICFWGIFNELLVTDGKRYKAYDAPQ
PFVRELHKLYKSVDPCRLTTLATCVDHQFYYGCSDLMAWNKYFRKPGNEQQVRQFYEKVR
KTSHAQPLGISEYGDAGSINLHYDPRYDKAKTHAEEYQLLTHEGYWKAIKDQQWLWCKTV
WQFADMQTSIRNEGDKMGMNDKGVVTYDRKTCKDIYYFYKANWTQKPMVYLTGRRFVNRT
HAVTDVKAYGNVEKATLFVNGKKIGTARRDEICRLVWPKVTLSEGDNHILIKTKIGSDLL
CDSCTWHLHSKEMPAEIAPISAPFKMPQLRRPFFPKRKVNIKEAGVSQNVKSTRAIQNII
DRLASKGGGTVIVPKGNWLTGRLILRSNINLHLEAGAELHFSGEIADYLPVVLTRYEGID
MYSLGAMVYANGAENIAITGEGKLVSPSRDCEISRRQDGGVSEDLNKIPLEERIFDGKEG
QPTFMPVFFGPIHCKNILVEGVTFEQSLFWNISPTYCENTIIRGVSVNSFGVGRTDGIDI
DSSVNTLVEYTTLDCGDDCFTLKSGRSYDGLHKNRPTENVVIRHCRVKRGVGGLAIGSET
AAMIRNVYMHDCVMENAHFPVFIKTRRPRGGGAEGVWMERVHIIHTDNAAFYWDMLGSQK
WVGDLAHRLPARPINELTPAFRKFHFKDIIVDECPKLVRAIGLPERPIEDVVFENIQAPN
RICDLQDVGRFIIK

Enzyme Prediction     

No EC number prediction in MGYG000004561_01044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	20	581	1.6e-90	0.6170212765957447
GH28	724	1077	4.6e-59	0.9015384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	7.77e-61	67	587	69	596	beta-D-glucuronidase; Provisional
COG5434	Pgu1	6.89e-58	694	1001	78	393	Polygalacturonase [Carbohydrate transport and metabolism].
COG3250	LacZ	1.88e-54	19	405	9	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.98e-30	51	438	100	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.42e-26	282	570	5	285	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72527.1	5.43e-307	20	668	28	683
QUT59650.1	8.29e-282	17	668	22	679
BCA48702.1	2.15e-279	20	668	28	680
QUT42023.1	2.77e-279	20	668	35	687
QUT69839.1	1.22e-278	20	668	28	680

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CMG_A	1.17e-157	20	665	4	652	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	1.75e-157	20	665	23	671	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3FN9_A	1.16e-115	19	677	4	673	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	1.10e-110	20	625	25	620	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
6MVH_A	1.65e-109	20	631	25	626	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.05e-78	25	630	56	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	5.74e-47	19	414	2	397	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	8.21e-44	20	493	2	463	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KM09	2.21e-37	7	625	32	665	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
A7LXS9	1.65e-36	67	630	106	701	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999217	0.000151	0.000146	0.000137	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004561_01044.