CAZyme Information: MGYG000004559_00369

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004559_00369
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000004559_8|CGC1	38462.89	4.233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004559	2216405	MAG	France	Europe

• Gene Location: Start: 34200; End: 35261 Strand: +

Full Sequence      

MSSIFLSSLAVAIVSLQTIFTVDPADTSRTVSCYRIPALAVTPDGSLIAAIDERVPSCGD
LKWNRDINIVIRRSTDGGITWSPAVRVADFPDGQSASDPSMITDPATGNIWLFYNFMDHD
AAPGIYRFHVISSEDNGLTWSEPTDITSQVAPDDWEEDFMFLTSGQGTVTRDGRMLHTMV
NLDKGLHLIESTDHGASWHLLPAAITPADESKILELPDGRWMISSRVNGQGCRHIHISED
NGRTWTGFPEPQLPDPGCNGAIAFYPFFNTTDPAGCLLSVNAADPDDRADLTLRYSLDQG
LTWSDGLLLHEGDCGYSDITVLPSGHIAVFFEHGGYSSNSVMILNPFAGQQVQ

Enzyme Prediction     

No EC number prediction in MGYG000004559_00369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	21	338	3.1e-78	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.02e-89	17	347	1	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.01e-26	64	327	15	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	3.10e-10	6	340	246	648	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	7.13e-04	125	246	3	110	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
pfam15902	Sortilin-Vps10	0.001	191	317	6	120	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APS40775.1	4.23e-123	25	339	39	353
QCX36955.1	4.19e-122	15	339	26	352
QFZ55957.1	2.48e-121	31	339	41	349
ASO05493.1	2.92e-118	28	340	40	352
QXD15092.1	1.51e-117	31	339	44	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MNJ_A	3.10e-45	34	332	200	521	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
1EUR_A	6.81e-41	34	334	25	346	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1W8N_A	2.52e-40	34	334	21	342	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1EUT_A	2.45e-39	34	334	25	346	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	8.44e-39	34	334	21	342	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.88e-38	34	334	67	388	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	4.44e-32	32	332	201	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
A5PF10	6.81e-26	31	322	75	377	Sialidase-1 OS=Sus scrofa OX=9823 GN=NEU1 PE=3 SV=1
Q99519	2.17e-24	31	322	74	376	Sialidase-1 OS=Homo sapiens OX=9606 GN=NEU1 PE=1 SV=1
Q5RAF4	2.17e-24	31	322	74	376	Sialidase-1 OS=Pongo abelii OX=9601 GN=NEU1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001705	0.997480	0.000208	0.000217	0.000184	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004559_00369.