CAZyme Information: MGYG000004547_01775

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004547_01775
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000004547_123|CGC1	43765.13	7.6213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004547	2604006	MAG	France	Europe

• Gene Location: Start: 4060; End: 5160 Strand: -

Full Sequence      

MGKYKIAVYAICKNEENFVDKWVDSMQEADGIFVTDTGSDDNTVQKLKSRGVVVNSVKLS
FWRFDVARNISLNFVPEDYDICICTDLDEILEKGWRKLLEEVWEKDKTTRLKYMYTWSFY
DDGKPKLTFWYEKIHTRKNFRWTHPVHEILEYYGDKPEHYSYQKNIQLNHYPDPEKSRGQ
YLNLLELSVKESPNDDRNMHYLGREYMFYKMWDKCIETLQKHLNMPSATWKDERCASMRY
ISRAYIGLGDYENAQSWLYKAIAETPYLREPYVEMAQLAYKQKDWIKVYFMITEALKIKS
KPQIYLSEPFCWNSTIYDLGAIACYNLGLYQKSLEFAKIANEMNPTDERLIQNLKIIKKK
FAEVKK

Enzyme Prediction     

No EC number prediction in MGYG000004547_01775.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.04e-09	5	164	1	168	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	4.59e-05	199	297	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0463	WcaA	3.83e-04	3	170	2	180	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	0.001	238	340	4	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
cd06423	CESA_like	0.003	12	107	5	107	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	2.12e-177	1	360	1	359
BBB90152.1	1.05e-173	1	362	1	361
ACV63874.1	7.79e-172	1	363	1	362
AQS58819.1	1.12e-170	1	365	1	364
QOX65321.1	5.54e-156	1	364	1	363

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004547_01775.