CAZyme Information: MGYG000004547_00053

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004547_00053
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000004547_2|CGC1	43198.83	8.1256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004547	2604006	MAG	France	Europe

• Gene Location: Start: 884; End: 1987 Strand: -

Full Sequence      

MEKWSIKMADCVVSGRPALNYEKWAYDNGVVMLGLLKVWKKTGERKYFDVCKEYMEEYIY
DNGMIKNYRPYEYNIDLINNGKVLFDMFKETKDEKYRRAIFKLRNQLYKHPRTSENALWH
KKIYRNQVWLDGLYMEAPFYAQFIKTFDSKRNYNDVIRQFVLCKKNMQDKETGLYYHAYD
ETHSEFWCDRKTGLSKNFWGRGMGWFVMALADVLEIIPKDHRDFKELADMLKDALDALIN
VQDSSGCWYQVLDKGHIKGNYLEASCSCMILYALLKALRLKIVFGEKYTEAIEMAFNGII
DEFVLITDNGFINLNKNCAVAGLGNKNKRDGSFSYYISEPIVCNDLKGVGAFILATYEYE
CYKKLWG

Enzyme Prediction     

No EC number prediction in MGYG000004547_00053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	21	360	2.7e-116	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.57e-112	24	360	34	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.24e-101	23	360	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA27102.1	1.32e-142	2	360	16	373
AUS29212.1	1.87e-142	2	360	16	373
AHM68548.1	1.87e-142	2	360	16	373
QPK52882.1	1.87e-142	2	360	16	373
QPK57962.1	1.87e-142	2	360	16	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.34e-135	1	360	1	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.94e-73	23	360	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.17e-73	23	360	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.76e-20	24	300	66	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.00e-18	24	300	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.06e-72	23	360	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.91e-36	135	358	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.91e-36	135	358	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	6.83e-28	24	301	29	288	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	2.93e-07	129	299	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004547_00053.