CAZyme Information: MGYG000004544_01631

Basic Information

• Species: Alistipes sp900290115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900290115
• CAZyme ID: MGYG000004544_01631
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	MGYG000004544_13|CGC1	87824.94	4.2836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004544	2598681	MAG	France	Europe

• Gene Location: Start: 16830; End: 19220 Strand: -

Full Sequence      

MKRIFKYALCTLLLGSLFAGCEKETTPERVNVQHPEEQEQIHRDNAYYQRLREYKKSKHK
LAFGWYGTWTAMGPSYQTRISNCPDSMDIISIWSQWHTLTPAQVADKEFVQKVKGTKVTY
TIFSNVMPEPFASMYDDPYCDEAIEAYAKAYCKDSMDKWNYDGIDIDYEPGFGAVGPFVG
NPAPELFNKLIVAMGKYVGPKSGTGRLFIIDGVPFAVRDEYVEYFDYGIVQAYSSYGYTD
LQNRFNNAANAGWKPEQYIFAENFEAYWKTGGVSHTTRDGQTVNSLLGMALFNPTQGEGG
GFGAYHMEYEYAHADMPYKYMRQAIQAVNPAPVGDYSKTLVALNEAGTEQFEVSVTPSGV
IYGEVNCTLSARISEPAEADTDLALAVDNSLIESYNHDNGTEYAAIDPSLVNISGPLHFA
AGTEASESDVQVAVTVASLADGEYLVPLLPTLAEGFGYDETGYVKYLVITKSTTTIKVLT
DGSQVENHSVMKRLDGSYSSLEATLTAHLSLGAISDVQFGYVADNALAEAYNEKNGTDYM
TIDASKVSLSGKLSFAQGEMSPTGGVTVTLSDLSVLQPGYTLVALRPDLESLSDYEPDAD
RGVKYLLIFLGEENLAAQQNLEPFEDDCTKIDNANNKLGWTVDITNLNTSIGGTGVWGYD
DVTTLFNGRDAGDMGFYAIFNNYYSWQVGLGGRITIDMQQSYPVSTVAWGVCYTNTAYSV
KTIRNVEVSTDGVNWTPQNAGDVTIAQATGDNGVMQWFTFVKPVEARLIRFDIVDRYDTG
SNFCGMRELEVWSPKN

Enzyme Prediction     

No EC number prediction in MGYG000004544_01631.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	7.42e-51	60	311	1	242	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam16141	DUF4849	2.98e-49	25	325	1	316	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
pfam08522	DUF1735	1.86e-08	336	448	1	111	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam08522	DUF1735	3.08e-08	458	596	1	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	7.05e-07	694	789	37	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL00953.1	5.03e-194	1	478	9	481
BBL08878.1	5.03e-194	1	478	9	481
BBL11670.1	5.03e-194	1	478	9	481
AFL77898.1	1.66e-187	1	485	1	485
CBK63302.1	7.16e-174	1	791	5	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	4.16e-39	47	336	58	363	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	3.98e-10	42	330	12	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	4.05e-09	42	330	12	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]
4NUY_A	9.81e-07	64	264	19	250	Crystalstructure of EndoS, an endo-beta-N-acetyl-glucosaminidase from Streptococcus pyogenes [Streptococcus pyogenes serotype M1]
4NUZ_A	5.04e-06	64	264	19	250	Crystalstructure of a glycosynthase mutant (D233Q) of EndoS, an endo-beta-N-acetyl-glucosaminidase from Streptococcus pyogenes [Streptococcus pyogenes serotype M1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	4.97e-10	5	308	6	305	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004544_01631.