CAZyme Information: MGYG000004544_01236

Basic Information

• Species: Alistipes sp900290115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900290115
• CAZyme ID: MGYG000004544_01236
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	MGYG000004544_8|CGC1	62830.24	7.8365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004544	2598681	MAG	France	Europe

• Gene Location: Start: 125865; End: 127562 Strand: +

Full Sequence      

MKHRFPLLLAGCLLALLPVMLLRDFTPSNELRYLSIADEALREGHLFTFTFQGEPYADKP
PLYLWLVMLGRLLFGQHQMLYLALLALLPAMVILATMERWLRTVVERRNRMTAALMLMTS
GLFLGLAVCVRMDMLMCMFITLALYSFWQLYTGTGSERLHRTLFALFTWLALFTKGPVGL
LVPLLSATLFLLVERKPRLIARCCGWYTWGIIAGCSALWFLAVWLEGGSEYLNNLLFHQT
IDRAVDAFHHKEPFWYYLVSYWYSLAPWSLLIAGIILTALVRRMRMTDLERLFLTVIVST
LVMLSLFSSKLAVYLAPTFPFFVYLAASLAQRMPPARWMKATVALPALIWCAALPAAVVL
RQNADLAFLGNGWCLAATALLTAAGIAALTLLWREQTLRHAINTLAAGLLAALFVGGMAL
PRLNTLLGYGTMCRQAVELARTNGTTAYYSWEVRRPESMDAYLGAPVRAVTTDEVLAGEV
TEGILMLAARKLEQDDAMQRFLAGKRLHPVGEYLLVEITPADTDTAEPAEAGSAEPTDTA
PTGTDAAETADTAVRIATPAPTDRQ

Enzyme Prediction     

No EC number prediction in MGYG000004544_01236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	477	7.6e-72	0.8870370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.32e-26	23	361	28	370	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.91e-13	30	341	33	344	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	0.003	58	201	1	139	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	2.33e-161	1	513	1	512
QTO25703.1	3.30e-161	1	513	1	512
QLK84536.1	3.30e-161	1	513	1	512
QUU03965.1	5.09e-155	1	513	1	512
QRP88934.1	2.89e-154	1	513	1	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.46e-06	22	365	51	399	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.58e-12	13	320	6	311	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	6.59e-07	13	271	18	275	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B7UFR9	1.52e-06	29	274	31	277	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.939529	0.060008	0.000176	0.000070	0.000071	0.000151

TMHMM  Annotations     

start	end
5	22
79	101
122	144
171	193
206	228
259	281
293	315
338	360
367	389
404	426