CAZyme Information: MGYG000004540_00318

Basic Information

• Species: UMGS1754 sp900554815
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1754; UMGS1754 sp900554815
• CAZyme ID: MGYG000004540_00318
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
138		15731.85	4.4662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004540	1492343	MAG	France	Europe

• Gene Location: Start: 4031; End: 4447 Strand: +

Full Sequence      

MRNISEFDLVEGGSTITQQLAKNIFFTQEKKFSRKMAEIFAAIDLEKKYSKNEIIEMYMN
TIYFGDGYYGIGAASRGYFEKEPSELTLDELTLLAGIPNAPGVYSLSNRPDLARQRQEQV
VACMIEYGYLSEEENPIK

Enzyme Prediction     

No EC number prediction in MGYG000004540_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	3	124	1.4e-46	0.6836158192090396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.38e-49	3	124	55	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.52e-46	2	134	43	175	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.15e-43	10	134	126	250	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.50e-38	3	134	109	240	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	9.82e-29	11	134	116	239	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	8.26e-55	3	134	96	227
QNM09777.1	8.98e-54	1	134	103	236
QOS67703.1	2.58e-49	9	132	112	235
CBL03605.1	1.96e-48	9	132	112	235
ACV56467.1	2.08e-48	1	133	104	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.29e-35	9	134	68	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.32e-34	9	134	68	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.20e-27	12	133	90	211	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	3.01e-27	3	134	81	212	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3HZS_A	4.10e-26	4	132	64	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.88e-36	2	134	108	240	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	8.89e-32	9	134	111	236	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P40750	6.70e-31	3	134	118	249	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q07259	1.75e-29	3	131	89	216	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q9KNU5	1.60e-28	11	134	116	239	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004540_00318.