CAZyme Information: MGYG000004537_01176

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; UBA3637
• CAZyme ID: MGYG000004537_01176
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		30174.98	10.1539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004537	1450923	MAG	Israel	Asia

• Gene Location: Start: 3666; End: 4451 Strand: -

Full Sequence      

MKLSVYIVTLNEAARLPRTIKAASAVADDIVVVDSGSTDGTVEAAERLGARVIFHAWKNI
SSQKQFAQNQCLYDWVLSLDADEVLSPDLIAEINRIKADPVHQAYKVRIGDMFPGFKKPR
RLAQKYNLVRLYDRRLSTMPDDLTHDRVRVGKNVSVGQLKGLIHHYSYLSLHQTWVKYNL
YTDELVKTALVKGKKYSRIRLVTEFPRQFFIYYIVRRQIFNGLWGLVMATTLAYFRFLKI
AKYFEAKQGLTFRDNTLDEFV

Enzyme Prediction     

No EC number prediction in MGYG000004537_01176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	93	5e-17	0.5823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.23e-69	2	229	1	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	1.13e-15	4	141	1	151	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.53e-14	1	251	3	259	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02522	GT_2_like_a	1.29e-13	3	93	1	93	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	2.52e-10	5	108	1	119	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCB18812.1	2.31e-65	3	247	4	250
QEL25842.1	2.31e-65	3	247	4	250
AOG07295.1	2.71e-64	3	247	4	250
APF38163.1	3.41e-63	1	247	3	251
ALA16465.1	1.94e-62	1	247	3	251

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q68XF1	5.89e-45	2	242	3	253	Uncharacterized glycosyltransferase RT0209 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0209 PE=3 SV=1
Q4UMM0	1.31e-44	2	246	3	257	Uncharacterized glycosyltransferase RF_0337 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0337 PE=3 SV=1
O05944	2.32e-44	2	242	3	253	Uncharacterized glycosyltransferase RP128 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP218 PE=3 SV=1
Q92IX8	1.97e-43	2	246	8	262	Uncharacterized glycosyltransferase RC0292 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0292 PE=3 SV=1
Q1RJ60	1.05e-42	2	242	8	258	Uncharacterized glycosyltransferase RBE_0523 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0523 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
219	238