CAZyme Information: MGYG000004532_01575

Basic Information

• Species: Akkermansia sp900548895
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900548895
• CAZyme ID: MGYG000004532_01575
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	MGYG000004532_28|CGC1	90694.79	7.6003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004532	2434720	MAG	Israel	Asia

• Gene Location: Start: 25122; End: 27668 Strand: -

Full Sequence      

MKSPQPAAASADRSTLPPTEETPPTEELPTPEESRGAASLDDPRERKKKRRRRWLTLAVM
IPLALAAALLYLLPFTQPSIDCSAPPDGEVRDRHGVLLGYRRDGEGMRTQPLPPGPLPET
LVRAVLCAEDARFYSHPGIDPISVGRAVAGRLRGSSRSGASTISMQLVKISRPAGRRSLG
TKIREALAARRLEIEHDKDDILRAYLNRVDLGNSCRGVEAAARYYYSRPAAELSLPQAAL
LAALIQAPGRLDPLRHPEAALSRVNALLKRLGAPPVSDLGLCILREQLPRGAAPGTLCLE
SGLQEACRRIAREEIDKLSGHHVSQAAVLIVHNPSGQVIARITSAFPESPEGGQLDGTRT
RRSAGSTLKPFVYLLAFEKGLRPGSILTDLPTLYPDRSGIEAPHNYNRRYLGPISVRRAL
ACSQNVPAMEALNRSGGPKALLPLLTRFGIHPEGSAADYGLGLAIGNAHVTLEELAAAYT
ALARGGLSCRLLNHLPDAPSGSVSRSAAGAEPRGSADGEPGATEGSGAPFSGGERIADER
LCYLVTDILSDVNARADSFGAGESLRFRFPCAAKTGTSSDYRDNWCVGYTGDYTVAVWVG
NFDNSSMDQVSGISGAGPIFHRCMEELYSRRHPIPGPGNSALARPALPAPDAHSAALFGL
RTEEPDIAAGAEEAGMPPCPDGLVRITIDSRTGLPAAEHTPPQYRARELALEEELPALRL
QAAAPGLYDAEGRVLLNSRYADWLAGSGLQDAYACDLQRASDRRAAILVPANGSRLLLDS
TLPNDGRLIELISTLPPARARWISPTLRLRRIGDRWFAELEPGEHSLIVEDGAGGASATS
SFTVERAR

Enzyme Prediction     

No EC number prediction in MGYG000004532_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	111	271	1.6e-50	0.9096045197740112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	1.57e-121	85	845	9	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	6.10e-106	83	846	32	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	9.73e-95	108	628	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.58e-81	92	678	60	646	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.54e-61	100	701	52	751	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO90206.1	5.66e-165	71	844	31	761
QWO87180.1	5.66e-165	71	844	31	761
QWO97002.1	5.66e-165	71	844	31	761
QWP49869.1	9.84e-162	65	844	22	758
QWP64420.1	1.53e-160	65	844	22	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	9.30e-41	112	622	159	688	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.06e-40	112	622	180	709	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
4OON_A	3.89e-40	97	600	21	694	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3FWL_A	4.05e-39	112	622	163	692	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
3NB6_A	1.59e-30	117	271	28	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.33e-51	54	635	11	572	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q00573	1.47e-40	117	633	79	632	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q07806	1.84e-40	56	600	13	721	Penicillin-binding protein 1A OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mrcA PE=1 SV=2
P02919	8.48e-40	112	622	216	745	Penicillin-binding protein 1B OS=Escherichia coli (strain K12) OX=83333 GN=mrcB PE=1 SV=2
Q04707	1.33e-39	117	633	79	631	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999601	0.000411	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
54	76