CAZyme Information: MGYG000004513_03022

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_03022
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		71681.96	8.8121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 699; End: 2624 Strand: +

Full Sequence      

MKYFFPILGCLLLALAGGAEEPEFYVGACTHFAQNKGTPSQNLEMAARAGIVSIRDEVSW
SRVERQKGKLVIPDYFGKYLDEAVKRGIRPLIIFDYGNRFYDGGGYPASDEAIEGFTRYC
EAIVRYAGDRVKLYQVWNEWDGGCGMRGYGRGTPEGYVKLLKTVYPRLKKIAPDAIIISN
SVCTGEKFLENTFRLGVLDYCDAIGFHTYNYTKLLHTPVEAWFKRMQNLRKLIHSYNGGK
DKPVFITEMGYPNHLSNSGSSEEESAIKLARLYLYARTLPFLKGLYWYDFQDDGWNSARN
ENNFGLVRADLTPKLPYFAMKSLAARLSRAELLESETRDGLLLLRFRNGKEQFLAAINQK
PGVDLQLIFTDTGSSRDALTLELVGSAPLTRPWGFRDWTAQKTEVVPNQLSVTVGEMPLL
LSGNVEEIRLTEVRPHAFDRTRQVKTAGLRLPAAFAEVLPAGETAQTMPFGTYRQLTDSR
YGGLNDLSAGFRANYTRDALLLELEVKDNVFHQPETAIETAWKGDSIQLAFQCIGAPFSV
RTEIDAALIGGKPAVMVRAAQGDRSRVPQCRIERRGERTVVYHLTIPARLFGLKAFDSGA
MLTGALLVNDNDGNGRKGFLSWGGGIGIRKDPGLYNLFIFK

Enzyme Prediction     

No EC number prediction in MGYG000004513_03022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	78	354	1.3e-26	0.6937354988399071

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.79e-39	477	640	18	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam00232	Glyco_hydro_1	1.35e-06	28	139	53	165	Glycosyl hydrolase family 1.
cd00241	DOMON_like	1.01e-05	482	622	13	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG2723	BglB	1.29e-05	43	139	65	168	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
cd09619	CBM9_like_4	0.001	485	618	34	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46868.1	7.53e-259	2	641	3	641
QCQ20833.1	1.52e-75	10	355	28	374
QKZ07105.1	6.41e-56	1	422	1	424
QKF50587.1	1.04e-54	7	356	13	361
QSB20244.1	3.86e-54	13	356	17	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.11e-33	20	360	100	449	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZT64	9.30e-06	41	228	87	273	Coniferin beta-glucosidase OS=Pinus contorta OX=3339 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001881	0.996628	0.000832	0.000221	0.000203	0.000209

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_03022.