CAZyme Information: MGYG000004513_02865

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02865
• CAZy Family: GH78
• CAZyme Description: Biotin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1033	MGYG000004513_169|CGC1	115564.61	6.1437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 2993; End: 6094 Strand: +

Full Sequence      

MNLTEILDRAAAGELLSEAELKLLLELEAPEDLARLYRAAYAVKLKYVDNRVRLRGLIEI
SNLCRKDCFYCGIRRSNSHVGRFAMTLDEIVAAARHAVEFRYGSVVLQSGERNDPAFVDF
IEEAVRRIKALPGNLGITLSVGEQSEAAYRRWFEAGAHRYLLRIEASNPALYAKLHPADH
RYEERLASLRKLREVGYQVGTGVMIGLPHQRVDDLVRDIEFFRKLDVDMIGMGPYIPHHE
TPLGREFPEYGERPERQLELGLKMIAATRLQLKDVNIASTTALQALAPDGRERGLLAGAN
VIMPNIGEVAYRQGYLLYENKPGTDENARLVREKLEQAIASIGETIAYDQWGDSRHFARR
NGADEGVPDRAHRESAAAVIDPAWSVETPVPEGAAPAGWLYPPGEYERFLLQKMRREVEL
MKLHVGYPGSFRQPSTVCWFRRRVRPGALLLRASGALSATLDGVPLAAELQSNGVLRLHP
EQEGVLTLRVETGSSGELLPGILPFPPLSWEASSDGDHFEAALPGGDPAGDPLPTLRLTA
AEYAPGRYDFGRELIGTVRIHSETRPEFGFGESTFELENRDPARSEQSLELVEAAPGRWE
TPGALAFRYLRVGAPSPVKVECDAEFTPERYRGAFAADEELNRIWMCSAYTLRLCIRHFL
IDGIKRDRLPWAGDLALSLLANAYTFADPEPVRRTLTILGDAGIGEQHVNGATDYTLWLL
ICHDLYLRYFEDPAFLERLYPGIAAMVRHLLESSSPFLPPGSWVFIDWVASRREPEREWN
SEEKESALQILFFRALEAAARLAERRQDGRLAERCRQRGGELKEKMLRNFDALHGLFPAN
PARPELGFYRHANILAVLSGLVDPAMARAIMEKLRGDELPPVGTPYQAALEILAFHRAGL
HETALSRLRTIWGGMLRLGATTFFEAYDASQTGNERYAFYRRPYGLSLCHAWSAGPAALL
PILFFGCEPTSDGWRTFRLAPSPLCRGKEAATIPTPAGAIRLWREEGRLREEFPPEITPE
VPLGTGNPDRRDG

Enzyme Prediction     

No EC number prediction in MGYG000004513_02865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	548	1021	1.8e-71	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK07094	PRK07094	1.93e-151	34	348	19	323	biotin synthase; Provisional
TIGR03956	rSAM_HydE	9.12e-113	36	354	31	340	[FeFe] hydrogenase H-cluster radical SAM maturase HydE. This model describes the radical SAM protein HydE, one of a pair of radical SAM proteins, along with GTP-binding protein HydF, for maturation of [Fe] hydrogenase in Chlamydomonas reinhardtii and numerous bacteria. [Protein fate, Protein modification and repair]
COG0502	BioB	1.72e-48	36	333	32	314	Biotin synthase or related enzyme [Coenzyme transport and metabolism].
smart00729	Elp3	3.15e-25	55	259	2	213	Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
PRK06256	PRK06256	3.38e-19	36	304	39	299	biotin synthase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44883.1	1.06e-216	367	1000	1	623
BCG53178.1	2.73e-126	362	1014	39	702
QTX05357.1	1.66e-89	391	1024	34	669
SDT18190.1	4.21e-76	399	1014	38	671
ANF32625.1	3.50e-72	399	1024	3	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7O1O_A	3.01e-77	36	357	45	355	ChainA [FeFe] hydrogenase maturase subunit HydE [Thermotoga maritima MSB8]
5FEW_A	3.10e-77	36	357	45	355	HydEfrom T. maritima in complex with S-adenosyl-L-cysteine (final product) [Thermotoga maritima],5FEZ_A HydE from T. maritima in complex with (2R,4R)-MeSeTDA, 5'-deoxyadenosine and methionine [Thermotoga maritima],5FF0_A HydE from T. maritima in complex with S-adenosyl-L-cysteine and methionine [Thermotoga maritima],5FF4_A HydE from T. maritima in complex with (2R,4R)-TMeTDA [Thermotoga maritima],7O1T_A Chain A [FeFe] hydrogenase maturase subunit HydE [Thermotoga maritima],7O25_A Chain A [FeFe] hydrogenase maturase subunit HydE [Thermotoga maritima]
7O1P_A	1.12e-76	36	357	34	344	ChainA [FeFe] hydrogenase maturase subunit HydE [Thermotoga maritima MSB8]
5FEP_A	1.13e-76	36	357	45	355	HydEfrom T. maritima in complex with (2R,4R)-MeTDA [Thermotoga maritima],5FES_A HydE from T. maritima in complex with (2R,4R)-MeSeTDA [Thermotoga maritima],5FEX_A HydE from T. maritima in complex with Se-adenosyl-L-selenocysteine (tfinal of the reaction) [Thermotoga maritima]
4JY9_A	1.16e-76	36	357	35	345	X-raysnapshots of possible intermediates in the time course of synthesis and degradation of protein-bound Fe4S4 clusters [Thermotoga maritima MSB8],5FF2_A HydE from T. maritima in complex with (2R,4R)-TDA [Thermotoga maritima MSB8],7O1S_A Chain A [FeFe] hydrogenase maturase subunit HydE [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X0Z6	6.33e-76	36	357	35	345	[FeFe] hydrogenase maturase subunit HydE OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1269 PE=1 SV=1
Q8TUB9	2.65e-22	4	336	7	332	3-methylornithine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=pylB PE=1 SV=1
Q46E78	1.27e-20	8	336	15	332	3-methylornithine synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=pylB PE=1 SV=1
Q72L21	1.45e-13	27	328	25	314	Biotin synthase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=bioB PE=3 SV=1
Q5SKN6	1.45e-13	27	328	25	314	Biotin synthase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=bioB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02865.