CAZyme Information: MGYG000004513_01927

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01927
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000004513_76|CGC1	52924.1	9.3285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 14752; End: 16149 Strand: -

Full Sequence      

MAGKFKPALVLLDKNRIVTLIKYSTFVLVAIVLATAVMRFSWESFEGLFSLEFVMSLGGI
LLGLNVFYYAFLLVLAYFMYKPHRTLSDEELPSCTVIVPAYNEGKTVLKSLDSILASDYP
ADKLEILAIDDGSVDDTWYWIKLAAARSEGRITPIKLEKNGGKRRALYRGIRQSTSEVIV
TVDSDSVVAADTLRQLNSPFIDSKIGGVAGDIRVLNIQDGILPRMMDVNFVFGFEIMRSA
QSVLRSVFCTPGALSAYRRTAMLPFLDEWVEQKFFGEPAHIAEDRALATYLMSEGHRIVF
QRDAIAHTMIPTDYRTTCKMLMRWGRGDVRETCSMYRFAFRKLDWFHLGIQFNLLMQTMW
LFLPVLFLPLTVMALCAAPVAFIQAVILGMIIWSSIPAFVYSTRRCSSEAIFAYTFAVFK
FFFLFWVDPYCLVTVRNSKWMTRTRTVRPQPVLRRNFSSSNPQAL

Enzyme Prediction     

No EC number prediction in MGYG000004513_01927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	95	261	7.4e-31	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.21e-45	96	261	1	165	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	1.92e-41	66	315	3	235	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
cd06434	GT2_HAS	1.10e-39	93	327	1	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	7.28e-37	47	401	10	354	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.17e-28	95	261	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA69456.1	7.13e-116	54	444	73	464
ALU26712.1	7.13e-116	54	444	73	464
APA92728.1	7.13e-116	54	444	73	464
QBK76751.1	7.13e-116	54	444	73	464
AQX10681.1	2.58e-115	42	448	68	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	3.20e-17	157	331	172	350	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	4.87e-17	92	311	42	249	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	4.91e-17	92	311	43	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
7SP6_A	1.33e-16	157	331	172	350	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6P61_A	2.67e-10	92	224	13	142	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07755	1.10e-39	92	443	48	394	N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodC PE=3 SV=2
P17862	9.37e-39	87	450	44	402	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2
P72334	9.71e-37	92	449	49	401	N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) OX=103798 GN=nodC PE=3 SV=1
P04340	1.20e-36	82	332	39	288	N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae OX=387 GN=nodC PE=3 SV=1
P26024	5.87e-36	87	453	44	410	N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
57	79
345	367
377	399
411	433