CAZyme Information: MGYG000004513_01822

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01822
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
988		110290.5	8.0816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 13542; End: 16508 Strand: -

Full Sequence      

MKFLSTFLLLGSSVALLGTPLHLDEKNVFAVKAKARGHQVAKLTLPDGSPAIGFHWDNGN
APFGEIVLSKPRLLGALPVQLSLKLQLSQRDSVEELRLRIVDSKGEIFQFRPISATGSDR
VEYNITPEGSDAHWGGDRNGRIDGEISLAGFAVVFRQPVKTGTAIAGDFELIRSELDAVR
VQLETDNPAAIILPEQEATAALSFEMIGNRAVNCRALCEFEDFYGKKFQRSGSFELTPAH
KGRLVFGPLPSRGWWRVRYQLSDRQGRKRSGELYLAALTPSGPTRGIAPGFLFGVHSHWR
RCTEAEKKREVILAAWAGIKALRYDIQWRELRPQPDSPWNFQKTDEALNLCRAYGIELEA
LLGAPPSWAVKPGFVRPRLDIRGEIRPRTDLYREYIRNVAEHYKGKIRFYEQFNEPDLAA
FYNFGAEDYAELFRAGAEEIRKADPAAQRLTGGFATMRQVASSHGPDYIEKALAGTRGFF
EVHAHHEHGTFEDYVRMIDGRFLPLRRKLGITGPWYATETALTAVDGRIRPQAASLWQKL
LFAWSRGAIAFNWYDLRNDGFDPTNGEHNYGLLTRDFQPKPVYVAYNTLTALFRTQKFIR
QLPAPAGIWLLEFCNEEKRLLACWRESNATPAALLLHTGASAGERTDLMGNTATLHPQNG
FLLLEAGEFPTALEVPAKENLTLAEDLMKAELAGAVVPGKEFTLRLSLFNPLAEKGEFSF
QLQAPTGIEFQNARQKIILSPGEKRQIAFHGNATRQFKLPFGTRGTMQLTGNLQQAGWSC
QLELPVNASVLIPAKRETNAPDFVLNQREQVFSLIGADPTKEHLNWKGPHDLSAAVQLGR
RQENFTLAVDVTDDRHFQPYSGANVWQGDNIQFAIALPGRGGMWELGLTRCDNGKSEVFC
WSAPDGLSPEKAVAAAHLETRRESGKTSYRLTIPFAVLGLTPDVLKTGFRFNLLVNDNDG
EGRENWIHIVPGIGQVKNPEKYPLVLLE

Enzyme Prediction     

No EC number prediction in MGYG000004513_01822.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	340	597	4e-19	0.6566125290023201

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.92e-74	801	987	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.04e-11	825	972	29	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	7.31e-11	815	968	1	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	2.71e-06	274	448	8	188	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
smart00633	Glyco_10	4.12e-06	328	447	3	123	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	1.83e-196	139	988	468	1307
AVM46276.1	6.71e-189	176	988	325	1137
AHF94342.1	1.51e-169	24	988	56	1033
AHF90198.1	7.73e-169	17	985	25	1003
AVM44759.1	6.12e-162	223	988	202	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	5.33e-08	553	675	375	498	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000572	0.998729	0.000193	0.000172	0.000157	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01822.