CAZyme Information: MGYG000004510_01448

Basic Information

• Species: Prevotella sp002481295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002481295
• CAZyme ID: MGYG000004510_01448
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	MGYG000004510_20|CGC1	32393.05	7.3527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004510	3097673	MAG	Israel	Asia

• Gene Location: Start: 8223; End: 9059 Strand: +

Full Sequence      

MIFVRDKGRMCNNILQYAHLYAWGREHYRATLSMRFAYKYRYFHICDTPHHSMVWYLMGK
YGAKLHLLPVVTFPLHEGDTTQQEQALLHHRHCVAEGWGVRFYDLFLKYKQEIIRLFAFH
NDVEATVTRRMRDAEGAASSGTGAVIRLGVHIRRGDYATWQGGRYLYTDEQYLNIIRQAM
ALHTDRRVMAYICGNDPQLNRQLYIDTLGAEHVCFPDGNPGEDLCLLSHCDALIGAPSTF
TLVASMYRDTPLYWIEDPDILLSPQSFSCFDELFRRIH

Enzyme Prediction     

No EC number prediction in MGYG000004510_01448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	246	5.1e-21	0.8659420289855072

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	9.01e-15	1	261	1	262	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.84e-06	109	240	129	258	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11296	O-FucT_like	0.008	109	249	41	202	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB65418.1	8.32e-120	1	277	1	270
QUB68171.1	1.18e-119	1	277	1	270
QUB58627.1	6.80e-119	1	277	1	270
QUB56031.1	6.80e-119	1	277	1	270
BBA29461.1	1.37e-118	1	277	1	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999791	0.000213	0.000018	0.000001	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004510_01448.