CAZyme Information: MGYG000004510_00268

Basic Information

• Species: Prevotella sp002481295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002481295
• CAZyme ID: MGYG000004510_00268
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000004510_3|CGC1	44833.87	9.231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004510	3097673	MAG	Israel	Asia

• Gene Location: Start: 74937; End: 76118 Strand: +

Full Sequence      

MRHLFYLCACLLLSLTAQAQTQTFDLSRQSKAGKPFSFSVAVPDGNYRVTVELGSKSHEG
NTMVRAESRRLFVENTPTKRGKFKTFSFVVNKRSPYITDKERVKLKPREKDYLDWDDSLN
LEFTGPHPAVRRVTITPDTTAVTLFLCGNSTVVDQPYDPYASWGQMITRWMGDGYAVANH
AESGLTASSFYFQNRLDKILSMMRPGDYVFCEFGHNDQKEKTPGSGAWYNFSYMLKTYID
KVRAKGGNIVFVTPTQRRAFDNSHQHILETHGDYPDAMRAVAKREHVPVIELHDMTRTFF
ETLGYEGSKRALVHYPANTWPNQPKALADNTHFNPYGAYEVAKMVVMGMKSLNLPMINGL
RDWKDFDPAHPDDPQLFRWTPSVRVNVVKPDGN

Enzyme Prediction     

No EC number prediction in MGYG000004510_00268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	143	347	8.6e-64	0.9857142857142858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	3.17e-77	143	346	2	195	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	3.93e-12	136	346	3	205	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	3.52e-09	148	297	3	152	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01827	sialate_O-acetylesterase_like1	2.49e-05	148	345	7	183	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01834	SGNH_hydrolase_like_2	8.67e-04	144	306	5	167	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85052.1	1.12e-194	13	393	1	380
AGB29274.1	6.04e-185	1	393	1	419
ADE81025.1	5.65e-177	20	393	10	384
QVJ82311.1	2.65e-175	20	393	10	384
QIM09958.1	9.40e-163	26	393	33	400

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	6.59e-51	142	356	6	219	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	1.35e-24	144	360	5	213	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000426	0.998556	0.000423	0.000188	0.000171	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004510_00268.