CAZyme Information: MGYG000004501_02048

Basic Information

• Species: CAG-312 sp900760665
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760665
• CAZyme ID: MGYG000004501_02048
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000004501_69|CGC1	49556.73	8.8531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004501	2469413	MAG	Israel	Asia

• Gene Location: Start: 4008; End: 5351 Strand: -

Full Sequence      

MQNRRSFFKTALFGACAFASRGVLADDIAESARKSKAGTANFSMRGFAAPKIGDLRIGVV
GCGTRGWTGISRFHLFDGARTAAFCDIVPEKVEGVKNYLKDRKLPEAAAYCGGDGEYKRL
CDRDDIDLVYIATPWKWHVPMAEYAMASGKHVALEVPAARTLGEAWRLVEASERFQKHCF
MLENCVYDFFEAATINMALDGALGEIIHAEGAYIHRIVQALPKKETWRWEENCRDGNLYP
THGLGPVSLAMSITRGDAFDYMTSMSSADFTWHKNAERARREIPSIPLFDKYRGNINSSL
IRTKNGKTIALQHDVSSPRPYDRKHILSGTEGFVQKYPDETVFLGGKKLPKGEAAKLLKK
YTPETIAKIGEFAKKVGGHGGMDTIMIYRLIHCLRNGLPLDMDVYDAAAWSAVTPLSVWS
AANRSEPADFPDFTGGGWKTCKPSKLS

Enzyme Prediction     

No EC number prediction in MGYG000004501_02048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	51	440	2.6e-145	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	8.90e-19	55	254	4	194	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.44e-13	55	181	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	4.61e-06	118	210	57	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYH38293.1	1.45e-163	4	447	6	459
AMQ56160.1	2.73e-163	1	447	1	457
AEV99796.1	7.15e-162	3	447	4	470
EAZ80128.1	8.04e-160	4	447	12	464
SMD44252.1	2.81e-158	3	447	4	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.13e-89	44	443	32	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.49e-55	55	442	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
5A02_A	5.07e-11	72	206	25	154	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
5YA8_A	1.10e-09	88	245	36	193	Crystalstructure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YAB_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAP_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAQ_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans]
6KTJ_A	1.46e-09	88	245	36	193	Crystalstructure of scyllo-inositol dehydrogenase R178A mutant, apo-form, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTJ_B Crystal structure of scyllo-inositol dehydrogenase R178A mutant, apo-form, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTJ_C Crystal structure of scyllo-inositol dehydrogenase R178A mutant, apo-form, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTJ_D Crystal structure of scyllo-inositol dehydrogenase R178A mutant, apo-form, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTK_A Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NADH and L-glucono-1,5-lactone, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTK_B Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NADH and L-glucono-1,5-lactone, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTK_C Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NADH and L-glucono-1,5-lactone, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTK_D Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NADH and L-glucono-1,5-lactone, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTL_A Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NAD and myo-inositol, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTL_B Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NAD and myo-inositol, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTL_C Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NAD and myo-inositol, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans],6KTL_D Crystal structure of scyllo-inositol dehydrogenase R178A mutant, complexed with NAD and myo-inositol, from Paracoccus laeviglucosivorans [Paracoccus laeviglucosivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MWF4	4.16e-119	50	442	53	460	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
P0C863	1.47e-118	46	442	45	456	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	1.47e-118	46	442	45	456	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZX8	8.27e-116	50	438	52	455	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A8H2K3	2.35e-115	3	443	4	450	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000049	0.000034	0.000007	0.998567	0.001345	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004501_02048.