CAZyme Information: MGYG000004501_01479

Basic Information

• Species: CAG-312 sp900760665
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760665
• CAZyme ID: MGYG000004501_01479
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811		91483.85	7.0494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004501	2469413	MAG	Israel	Asia

• Gene Location: Start: 25407; End: 27842 Strand: -

Full Sequence      

MKNLFAIIALFGAHSAGFAGVSDISPSAVADNAYDIRVWDAYPVRETPDIWKNIPPILKE
ADWIWPFPSNYVDVANSYALFRETFELSEVPQKAVMYITADQNYRLYVNGKYVCKGPARG
FQKSWPYDEVDIAPFLKKGKNAVAVRAYNAGRNTFSYLSAGFAGVLYGVDLGGGKKIVSR
KATKCLRQNSCDRDTAPYSMQLNNQEHIDMRADPAGWTLPNFDDSAWVNTESARRWNQMP
FYAYEPRFTPLGESRMVPVKLIGEGSGKSASDAERYRNISELVAREDTSHRAVSSDSEVL
KVPPSPKGGFRSYLFDFGKVAVGVPILEVRGAKGGEIIDMCLVERVSDKLEPVNLYLTHS
APAMSNRMIARAGDNRHEFYHALGARYMMLRVRANPDSELEIRPSFRWEAYPLGHDGAFE
TSNPLANKIWKACEQTQRVCSLDAYVDTPHREQAQWWGDARVQAWNTFMLCDDPRLLWRG
IRQIAMQTAPNGLTYGHAPTMAHHCILPDYSVIWILTLYDYYWQTGDASIFDKYEKTIDG
ILSYFDGATNPATGLVSYDPRFWLFLDWTNIQREGDPAVLNLWLLYALDTVSRTCAETGR
AEMAAKYSARAAKLRAAIEKNLVDSDGLVRDGILPDGKPNPLKGIQSQVLGRMANLKGFD
FEKAKSEILLPFLRGELKTHADPSSYWHVYLYDLMAGEGHGAEVYADILKKWREMADYGT
AFENFETRRSANSSSHAWSAHPLFLMPRILGGIRQTAPAWRKVSFNPLFIEDSGSIVWPT
PRGKIRLEWRKLPDGSFEKKLDLPEGIELSE

Enzyme Prediction     

No EC number prediction in MGYG000004501_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	312	808	4.3e-80	0.9742063492063492
CBM67	61	240	2.5e-39	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.88e-22	417	632	4	224	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.28e-08	91	231	3	151	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	6.49e-06	752	806	1	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	8.60e-06	62	148	92	178	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3408	GDB1	1.49e-05	509	766	339	630	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT92885.1	5.82e-244	63	807	12	756
QYY35421.1	7.70e-237	55	807	11	761
SDU02729.1	2.01e-235	63	808	18	767
AHF89243.1	2.06e-224	57	807	15	790
QYM78626.1	1.13e-206	57	807	14	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.46e-21	306	787	190	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.09e-16	61	261	8	208	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	8.70e-15	66	808	166	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000532	0.998680	0.000189	0.000215	0.000179	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004501_01479.