CAZyme Information: MGYG000004490_01859

Basic Information

• Species: Muribaculum sp003150235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp003150235
• CAZyme ID: MGYG000004490_01859
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000004490_20|CGC1	88223.82	5.2243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004490	3323418	MAG	Israel	Asia

• Gene Location: Start: 38048; End: 40402 Strand: -

Full Sequence      

MKAFASMIIACGIAVSAYPQQALYPSSFPLGDVQLLDSRFSKAQALNVDVLLKYDVDRLL
APYLKEAGLTPKAESFPCWDGLDGHVGGHYLTALAIHYASTGDPRLKERMDYMISELKRC
QDASGNGYVGGVPDGKPLWDGLKSGNIELVWKYWVPWYNVHKTYAGLRDAWLYAGDAQAR
DMFLKFCDWGLDIIAPLSDEQMEAMLDQEFGGMPEVFADAYAITGYRKYLDGARRFSHHW
LLDSMAAGVDNLDNKHANTQVPKVVGYERIAEVADDSLYRDASVFFWETVTGTRSLSIGG
NSRREHFAPKDDCKSYVTDREGPESCNTNNMLKLSEGLFRMSRDARYADFYERALYNHIL
STQHPVHGGYVYFTPARLAHYRVYSQPNSGMWCCVGTGMENHGKYGEFIYSHFGDSLYVN
LFIPSRLDWKEKGLTVTQTGDFPADDSVSFTVDVKKPARFTLMLRHPGWCDDMQLTVNGK
PVSVTSAPQSYLAIDRKWKKGDRVDLKLPMKVSVEEVPNVPDYISVVYGPVVLAARYSTE
GLDGLVADDSRWAHIAHGPLVSVFDTPVLIGSREEIVDALKSMEPVEGKPLHFRVPRLLK
GKYASMELEPFADIHDARYMLYWLSMTQDRYDNYLKMEKAAEAMSLDLDRRTIDVVKPGE
QQPEADHFMANEQSKTGYLNDVAWRDASDGGFFSYRMKPAGEKGALLLVKYWGNEPEGRQ
VEIYIEGELIASENLSGKWGIDEFVTESYALPEWVTANDAVTVTFQSVERGNTGGIYDVR
IVKP

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	32	534	3.3e-204	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	32	534	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.32e-126	33	535	12	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	6.18e-36	539	623	2	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	7	783	12	786
ADY37333.1	0.0	12	783	13	796
QCD43163.1	0.0	1	783	1	785
SCV06553.1	0.0	2	782	5	796
QRQ58640.1	0.0	2	782	5	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.33e-228	6	783	5	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.20e-221	6	783	5	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.07e-21	271	596	281	624	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	8.50e-21	324	543	381	612	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	4.04e-20	271	596	281	624	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999110	0.000159	0.000159	0.000148	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004490_01859.