CAZyme Information: MGYG000004490_01070

Basic Information

• Species: Muribaculum sp003150235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp003150235
• CAZyme ID: MGYG000004490_01070
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35134.44	6.3342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004490	3323418	MAG	Israel	Asia

• Gene Location: Start: 106320; End: 107285 Strand: +

Full Sequence      

MKSTVIFVISLLMAFGLMHAADAKGYDIVVAQDGSGDFTTIQEAVNSVPDFRKKARTTIL
VKKGVYKEKLIIAPCKINLSIIGEDGAVITYDDYASKLNRFGDEKSTSGSASCYIYAPDF
IAENITFENSSGPVGQAVACFVSGDRATFRNCSFLGCQDTLYTYGVPSRQYYENCYIEGT
VDFIFGKSTAVFNRCTIHSKGRGYVTAPATEKGASYGYVFHDCTLTGADGVEGVYLSRPW
RPYAQAVYINCNLGRHIAPAGWDHWGKESNKESAFYAEYRSTGDGANPAARVPYSRQLDD
ISRYDIATVLAGDDGWNPLAR

Enzyme Prediction     

No EC number prediction in MGYG000004490_01070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	300	4.6e-101	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.26e-82	30	300	9	284	pectinesterase
pfam01095	Pectinesterase	2.75e-79	27	313	1	298	Pectinesterase.
PLN02682	PLN02682	1.57e-71	26	300	69	349	pectinesterase family protein
COG4677	PemB	1.38e-67	23	312	78	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	6.20e-64	27	318	242	550	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41759.1	2.10e-180	21	319	20	318
ALJ61265.1	2.17e-164	24	319	282	577
QUT93206.1	2.17e-164	24	319	282	577
QDO69180.1	1.00e-162	24	319	282	577
QIU94488.1	8.53e-157	24	319	273	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.00e-46	29	294	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.77e-46	25	294	6	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.58e-38	28	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	1.70e-38	12	286	17	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	8.51e-38	28	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.33e-64	30	300	9	284	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.05e-53	32	300	90	363	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	1.11e-52	29	310	274	567	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	4.72e-52	29	310	261	554	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
O49298	5.22e-50	27	313	250	540	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999123	0.000162	0.000155	0.000144	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004490_01070.