CAZyme Information: MGYG000004484_01261

Basic Information

• Species: UBA2903 sp002349565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA2903; UBA2903 sp002349565
• CAZyme ID: MGYG000004484_01261
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		67799.77	10.0621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004484	1902889	MAG	Israel	Asia

• Gene Location: Start: 9444; End: 11330 Strand: +

Full Sequence      

MAKKTANSPKSAKSKPKKTAVPKKRTDKRIGFDWKKAVGHFKHPLRFVWIGAAAVAVYLV
YCWATLPDIAKAVKASRPPKLVVLAADGTELASYGAKYGNPVDLNTLPPYVPQAVVATED
VRFYSHFGLDIRSIIRAAVTNLIKGRKAQGASTITQQVAKNLFLSSQKTFRRKVQEVMLS
LWLEHNLSKDRILTIYLNRVYFGAGTYGLEAAAQKYYGVKARRLSLYQAAVLAGLLKAPT
TYNPLTHPEAANKRARIVLANMAKAGYISATEGLDAAETGAKTGDGKNKSAFYFTDWIAD
ETNAYLGSISQDIAIRTTLQPEMQTVLTNELTAALNGEEAREKHVSQAAGVIMAPDGAVL
AMVGGKDYTKSQFNRAAEARRQIGSTVKPFVYLTAFEQGAAPSDIVEDKPIYLNGWSPKN
ASGRYYGKISLHDALVRSVNTVAVATALKAGVRNVLKTARKFGVVGTDCKAEAAIALGVC
QTRLIDLTAGYAALSNGGIGVMPYGISEILGANGEILYQRDSDGRGRLVNPRYIVDLDTV
LIDVILKGTGKKANPGILAKGKTGTTQNYRDAWFVGYTRDFAAGIWVGNDDETPMDKVTG
GGLPAEIWGKVVREISFDPDDDAAYSGL

Enzyme Prediction     

No EC number prediction in MGYG000004484_01261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	87	262	3.3e-67	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	0.0	28	608	1	589	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	0.0	98	616	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.22e-143	50	609	18	712	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	5.56e-101	102	608	150	675	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	2.78e-91	74	619	5	552	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT69091.1	8.25e-177	48	608	66	627
QPO11989.1	2.89e-174	45	608	56	621
AXO16624.1	4.35e-174	45	608	58	623
QEX14746.1	8.19e-174	66	608	58	600
QJR98160.1	1.02e-172	5	615	2	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	6.51e-75	81	608	21	708	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	1.40e-73	81	608	21	715	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	6.91e-65	108	628	165	711	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	9.40e-65	108	628	186	732	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	2.26e-61	108	628	169	715	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	8.88e-89	57	622	21	675	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P0A0Z5	1.09e-86	47	613	16	703	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	1.09e-86	47	613	16	703	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
O86088	8.15e-85	51	613	20	703	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
O05131	3.07e-84	47	613	16	703	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999933	0.000038	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
45	67