CAZyme Information: MGYG000004479_02712

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_02712
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000004479_41|CGC1	84616.04	6.4585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 2990; End: 5218 Strand: -

Full Sequence      

MKNTKQLVLGLIACCLSVYVQAQVWTMKGKEAAAPGSWWCFRNAVTLDETPRSLELRLGA
DTKYWLWVNGELQVAEGGLKRGPNPSDTYCDVITSLPALKAGKNTVAVLVWYFGKDGFSH
RNSLTAGISFSLTCDGKQVEPDAKWRVRMHPAYYVPQGEQPNYRLPESNIGFDAAKDIPF
QSPDYDDKKWKKATEISLEKAGWNCLVDRPIPFWKDYGLKPYARTEMQGDSLLRAYLPYN
AQVTPYLRLKAPAGKCIRIRTDNYRGGSAPNVFAEYRTREGEQEFECKGWMNGHYVQYEL
PEGVEVLDVKYRETGYDTSFAGSFACDDPMLTRLWDKAQRTLYITMRDTYMDCPDRERAQ
WWGDVVNELGEAFYALDEKAHLLTRKGIHELMGWQRADSTIFAPVPAGNYKDELPMQMLA
SVSHYGFWTYYMGTGDRQTILDVLPRVKKYIHVWKTDSLGLVVPRSGGWTWGDWGENKDM
TLLFNLWYVIALKGYEEMNQLAGEPEEAAWAHATADRLREVFHRTFWNGKYYVSPGYQGK
PDDRAQALAVVSGVLPEELYPVIRPFFSEWYHASPYMEKYVLEALCTMGYYQDALNRMKL
RYHAMIESPLTTLWEGWGIGSEGFGGGTYNHAWSGGPLTILSQYIAGIETVEPAFRTFRV
APHPAHLNFIRTQVPLSGGRRIVLEMDKSAHGGTMYLRVPEGTSAEVELPAEFRSWRVNG
EPESGRQLRLSAGEWRFEMQAD

Enzyme Prediction     

No EC number prediction in MGYG000004479_02712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	254	709	2.7e-85	0.9404761904761905
CBM67	25	197	7.1e-28	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.84e-25	321	645	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.38e-05	647	712	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	5.60e-05	316	532	17	216	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam17167	Glyco_hydro_36	0.002	472	558	188	290	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL36670.1	0.0	1	739	1	738
QDH54696.1	0.0	1	739	1	738
QUT48047.1	1.09e-256	7	710	6	715
AGY53286.1	2.72e-253	25	720	30	733
QKH97686.1	1.67e-248	15	710	26	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	8.61e-09	222	644	85	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000575	0.995175	0.003446	0.000270	0.000247	0.000232

TMHMM  Annotations     

start	end
7	25