CAZyme Information: MGYG000004479_00131

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_00131
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	MGYG000004479_2|CGC1	79681.71	5.1805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 7008; End: 9056 Strand: +

Full Sequence      

MKKQVICSLFALLVVGQLWAQNLYTRYERMLTLPEGYVCYRTNGKIKIDGKLDEADWKKA
QPTASFVDISGKGFAKPCYDTSAKMLWDDYYLYVAATLQEEDIKAKLSQRDTIIYYDNDF
EVFLDPDGDGQNYFEIETNAKGVIFDLMLDKPYRSGGNFMVQWDCPGLQLAVHREGTLNK
SNDKDTQWTVEMAIPHKALTVNFSNPAKEGNYWRINFSRVQWLKPGQREENWVWMPTGRI
DMHMPDRWGFLYLSDKVVGKGTEAFKYPYNWAAYKLLWAMFYAQLDYYAKEKNYLRAKEN
FFLTDAELRDLPVGAEILVEATSRTFCMSVSVPEEKVRYVVDQNGRFTCEAIVPRQVKNW
VWMRIDKEKGDEFYKNYFALMKECGISGVMFEGYDENTYRMCKDAGLEAHYWKWTMNRKE
VLEAHPDWFAVNRKGESCYDKPAYVDYYRFLCPNHEGVAEYLAADYLKEANLPYVDGVHL
DYVRFPDVVLPVSLWKNYGIEQTAELPEYDYCYCEVCRRMFKEQTGKDPLELKYPMEDQS
WINFRLDAITRVVDKITQTLKAEGKQISAAVFPGPSMARKMVRQDWGEWSLDAYFPMIYN
GFYYEGPEWIGRSVKESVQTVHGKARIYAGLMFPDIKNTFEQALDEAFNNGASGVSFFDG
PDEEYLRKFKAYLDKRGLEVVK

Enzyme Prediction     

No EC number prediction in MGYG000004479_00131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	48	251	7.4e-41	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	5.15e-73	48	250	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	4.28e-31	37	220	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
COG1649	YddW	3.11e-12	406	659	128	368	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
pfam06452	CBM9_1	3.10e-10	48	205	1	138	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	3.31e-08	48	201	4	143	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ32632.1	0.0	20	679	26	685
CUA18365.1	0.0	1	679	11	686
QRP90424.1	0.0	1	679	11	686
AUI46257.1	0.0	20	679	26	685
AKA51642.1	0.0	1	679	11	686

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000601	0.998584	0.000237	0.000184	0.000188	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004479_00131.