CAZyme Information: MGYG000004476_00913

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259
• CAZyme ID: MGYG000004476_00913
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000004476_12|CGC1	57555.04	8.9694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004476	1651123	MAG	Israel	Asia

• Gene Location: Start: 33405; End: 34922 Strand: -

Full Sequence      

MAEKKIVTEKPKAAKLPVKRPKAGKLPEIKVTEKKKIVFFGSEAAPFIATGGLADVMGSL
PKALARNKHNEVSVILPLYSNISLEFKSQFRFITNFNVSLGWRWQYAGVFVYEYEGVKFY
FIDNEYYFRREGNIYGFYDDGERFAFFSRAALDALSRLNIYPDVLHCNDWQTAASIIYLK
GMYYNDEQYRRIKTVFTIHNIEYQGVFGMDTYESLFGFPESIKQYIEFSGNVNLMKAAIE
MSDVVNTVSPTYAEEIKNPYYAHGLESIINRNAHKLYGILNGIDIDYYNPATDKYIFKNY
SLMDLSGKAVCKSELQKLLGLPVRADVPVIAIISRLVQHKGLDLVKAIIENLLSSDVQVI
ILGKGEIAYESFFTNIARSYSGKCAAIIAYNQDLSRKIYSGADIFLMPSKTEPCGLSQMI
ASRYGTVPVVRETGGLNDSIKAYTGDSGNGFTFKNYNAHDMLYVINEAVRTYREPIKWKD
VQKRAMSTDFSWKISAERYEKLYER

Enzyme Prediction     

No EC number prediction in MGYG000004476_00913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	36	504	3.2e-176	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	36	505	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	0.0	36	505	2	477	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	36	505	2	462	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	36	505	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14098	PRK14098	1.16e-105	36	503	7	483	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60006.1	2.45e-163	36	504	2	470
QIA32150.1	3.56e-161	37	503	3	472
ANU40325.1	7.14e-161	37	503	3	472
QQR06905.1	7.14e-161	37	503	3	472
QNL45767.1	1.25e-158	35	505	21	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	8.69e-87	30	504	122	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	5.73e-81	36	505	2	475	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.97e-80	42	505	8	475	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
6GNE_A	5.06e-80	37	505	12	496	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3COP_A	1.52e-79	42	505	8	475	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	3.34e-150	36	505	2	473	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A0PY73	2.10e-148	37	503	3	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
Q97GX6	1.27e-146	36	503	2	473	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
B7GK04	1.04e-144	36	504	2	472	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
A4IS20	2.16e-144	36	505	2	473	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004476_00913.