CAZyme Information: MGYG000004474_00472

Basic Information

• Species: Sodaliphilus sp004557565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp004557565
• CAZyme ID: MGYG000004474_00472
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46041.89	7.3561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004474	2861939	MAG	Israel	Asia

• Gene Location: Start: 57455; End: 58699 Strand: +

Full Sequence      

MTRTIKLALLSLAMLTSVAACAAQQKKTEVKNDEGATAASTSVVLAADRIDQYVPLLKGK
RIALLSNQTGITSKGKHVLDVMLENGLKVTEIFSPEHGFRGKADAGEHVSSSVDEKTGIP
IASLYDGKSNRPSKESMDKFDVLVTDLQDVGLRYYTYYITMANLMEACIEHNKEFVVFDR
PNPNGMYVDGPILDMELKSGVGRFPICTVHGMTMGEIALMANGEGWLKDGKQVKLTVIPC
LNYTHQTRYELPIAPSPNLPNMLSIYLYPSICYFEGTTVSLGRGTDQPFQCYGHPDMTCR
PFDFTPTSRFGAKTPPQQDKLCHGVDLRGLKYEDVIARGIDLTYVVDAYQDLRSQGKQFY
LKTGKRNFFNLLMGNTQVAEMMEAGKSSTEIKASWQPDVEKFKAQRKPYLLYAE

Enzyme Prediction     

No EC number prediction in MGYG000004474_00472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	62	412	1.4e-114	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	6.31e-171	63	412	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	1.41e-93	3	412	2	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI48832.1	3.10e-171	9	414	5	388
QCQ31137.1	4.40e-171	9	414	5	388
QCQ44443.1	4.40e-171	9	414	5	388
QLK81838.1	4.40e-171	9	414	5	388
QRM69467.1	4.40e-171	9	414	5	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	6.87e-160	41	414	4	370	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	9.97e-45	51	412	22	398	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	6.43e-73	50	412	45	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000012	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004474_00472.