CAZyme Information: MGYG000004471_01216

Basic Information

• Species: UBA1394 sp900554975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900554975
• CAZyme ID: MGYG000004471_01216
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732	MGYG000004471_17|CGC1	79282.23	4.2518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004471	1997651	MAG	Israel	Asia

• Gene Location: Start: 10274; End: 12472 Strand: +

Full Sequence      

MVKTNLIGRLKAAAISAVMITTAFVTPSIATINSVTAAGGNTITVNKTLIADGLETEDSK
KNTKVPVSLTSESKTITFNFETEYTDDVTIGISGAEINAKPWWVDLGGEIKTKAKDGKIT
ATYTLPSTLDKESVKSIDVGIWYPKTNETFKLTTVALDASGSSSGEDPSKPAEPIVSKND
KSGTCTFKDNGDGTADITSTLTAEISDVNYTLTAGYDEELYAPYNKDPDAKEWQEGDPIN
SHKFKWSEFNIADIDNVTFQSFNYVIESDVDMKKLMYGGGINVKKDCVADTEAVKGKDGY
WYNDQGEEDVEKYGDKFLIDDYATGYTVEDAGTYAKIVWDVPKSVQEWVTKGSDSAVGIQ
FWYGQDGSSEEYKEIETVKLTGASCTYTRKMTVPYNKTINKKTNQKLTMGTDDTKNQIKL
NLADLGLKERDKLSAIKFTVSGTGVEKMQFGVGISTDIENPMATKGWYQPGNITVLDDGT
RKSFEIMWILPDVVRNDVDLVSELGNLMFGYWYGGGKDGNEIANVTLDSVDFYTFQSKEK
ELTVSPSEFEITVGEKKQLTTSVDGCTFVAASATGGEYFTVDKSGNVEALAPGAGTITVT
SPEGQEVVVTVIVKAAQTTTTTVTTAATTTTTAVTTTTTTTTADPDPIDWSKVKYGDVDL
DGDITATDIVLINKYVLSSAEYPFVNATATENANAHYDKDENGKGIINLSDSNDVISVVL
GIFKESDLGPQK

Enzyme Prediction     

No EC number prediction in MGYG000004471_01216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM79	411	522	2.5e-19	0.9363636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18522	DUF5620	1.66e-19	236	381	1	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
pfam18522	DUF5620	7.53e-17	412	530	1	116	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
cd14256	Dockerin_I	2.85e-06	655	711	1	48	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam02368	Big_2	0.001	543	608	4	73	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
cd14256	Dockerin_I	0.005	644	677	24	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17555.1	1.31e-98	5	539	4	511
EWM54821.1	2.50e-71	3	533	2	543
CCZ83178.1	6.27e-51	177	700	241	853

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001064	0.997929	0.000334	0.000256	0.000202	0.000157

TMHMM  Annotations     

start	end
13	35