CAZyme Information: MGYG000004468_00259

Basic Information

• Species: Alistipes_A sp900539755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900539755
• CAZyme ID: MGYG000004468_00259
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000004468_1|CGC3	56615.94	5.1229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004468	2418771	MAG	Israel	Asia

• Gene Location: Start: 313780; End: 315294 Strand: +

Full Sequence      

MTRKLLPLLALLALASCTGQSKKDVELTTPSALQLEFMDNEIGAFFHFTTNTYTGAEHGD
GSASVSVFNPTKIDLDQWMQTAKDMGAKYAILTARHEDGFCLWPTKTTDYNISNSPWKDG
KGDLVKDFVEACRRHGLKPGLYFSPYFNAHAAFHPTDDKVTWGKKWDSLVRVRLQDSTFL
REFCQLDMDQITELMTNYGPIYQVWMDHWSDNMNCDSVTAIIRRLQPDCIMTGPDIRTPG
NEKSTALYPSWNAVFTKDSTNSSRAVELVPATDGPNEYGLLETAKVSGHPYGKFWRNVET
PTADIFNHGGWFWHGPQIPMSMEERIEAFYRSVGLGATILINLPPDQDGLIPAETVADAK
AWGDTIRKMFYGPYIAETTETQQGNEVELSWETPCRIDHVMLMENLANGQKVAKYTLEAF
VDGQWQPVTPANQFKYCPEGFNNNPGFETIGHKKIDRIVPVVTNRMRFRCTEAVAEPVEI
AKFAVWNLGQDAPATTTEATAQAK

Enzyme Prediction     

No EC number prediction in MGYG000004468_00259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	27	365	1.2e-64	0.869942196531792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.65e-44	30	422	11	386	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	3.38e-35	68	354	79	316	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	9.48e-35	68	386	76	348	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam14871	GHL6	0.005	74	138	1	61	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG53910.1	9.27e-290	8	496	1	490
QDT68951.1	7.54e-165	25	487	38	512
CAZ94419.1	2.29e-162	5	487	10	501
CAZ94418.1	8.15e-157	18	486	22	493
SDT35978.1	1.73e-113	12	488	16	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GZA_A	1.63e-72	26	488	6	442	Crystalstructure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482],3GZA_B Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	3.96e-69	16	472	17	445	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	5.19e-63	30	477	39	455	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	1.48e-62	30	487	10	455	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	2.31e-54	30	366	19	347	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	1.02e-55	27	487	37	477	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	5.94e-55	27	465	35	456	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q99KR8	7.52e-10	45	429	80	426	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q9VTJ4	1.34e-08	64	160	108	196	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q6AYS4	2.20e-08	45	393	78	379	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004468_00259.