CAZyme Information: MGYG000004465_00409

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004465_00409
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43814.81	8.7361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004465	2247261	MAG	Israel	Asia

• Gene Location: Start: 36148; End: 37281 Strand: +

Full Sequence      

MKVLYCINGTYNSGGMERVLMTKANYLADVMGYDVTIVTSQQKGRPNFYHFSPLIKFYDL
GINYEEDRNYGLLKRTIHTWHKKKKHKQALTELLNTIRPDICISMFDYEFDFLYKIKDGS
KKVLEFHFCKEQKLIEAPNTIMRIIQYIRVNWIWQEIVRHYDKFVVLTEEDKKAWKNLDN
TIVIRNPIPDIPLEQASLNVKRVLSVGRISYQKGFERLLKAWALIPDTFKEWTLTICGNG
DSTELQNLSKTLNIDSSVIFKPATPKISEEYLNCSIYAMSSRYEGLPMVLMEAMSYGIPI
VSFDCPCGPKELIQNHETGSIVHNGDIAGLASELEKWMKNEQKRKRAGEKARTCASQYVQ
DKIMQQWITLFNSLLLQ

Enzyme Prediction     

No EC number prediction in MGYG000004465_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	202	347	4.5e-36	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03820	GT4_AmsD-like	4.20e-113	2	369	1	351	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	2.24e-54	2	360	1	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.10e-49	2	372	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	8.48e-42	201	352	3	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	5.87e-41	1	375	1	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT40838.1	4.70e-105	1	374	1	373
AQX83631.1	2.08e-104	1	372	1	371
QQN57031.1	2.08e-104	1	372	1	371
QDZ63599.1	2.08e-104	1	372	1	371
QNV08794.1	1.62e-103	1	374	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	1.76e-15	161	372	272	491	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
6EJJ_A	1.93e-15	1	370	3	353	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]
5N7Z_A	7.78e-15	204	343	184	327	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	7.84e-15	204	343	185	328	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	7.89e-15	204	343	186	329	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05083	3.26e-43	2	367	3	349	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q46634	1.37e-29	2	372	3	351	Amylovoran biosynthesis glycosyltransferase AmsD OS=Erwinia amylovora OX=552 GN=amsD PE=3 SV=2
P27127	1.59e-15	1	341	1	323	Lipopolysaccharide 1,6-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaB PE=3 SV=2
P13484	1.23e-14	54	375	171	523	Poly(glycerol-phosphate) alpha-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagE PE=1 SV=1
Q06994	4.26e-14	204	343	184	327	Lipopolysaccharide 1,6-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004465_00409.