CAZyme Information: MGYG000004461_02888

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_02888
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	MGYG000004461_29|CGC1	65609.22	9.5303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 37714; End: 39444 Strand: +

Full Sequence      

MNKTLILCAAAVTTLTLSGGSLMPEKGKISIHGADGASFQKQGEKLILKWEKTPVNLFLR
GLIRFHQNLDGNPAPDDALVLELKTEKDVSIRTRWNGGGNLPKYAIKGKKEFQEVILPMP
ESRGKKLTALDLQFTPDPGRVEIRKIEIAKPRKVTLKADEYPTKIQKEITFRGTTATPET
EVTVSIRNAEGKVQSKTIRSKNGKYELVWKRPPVSEGQWNTAYAQIGSGKDSAETSIPLS
LFGYRADDEFAWIRVKGRHFMTSPLSRDGEQKFIPVGIGYCRDVIIPAQDEEVMKFCKAR
HLNTIRLSFYTRFFNNNEKAPLEIEEHIRDFILPVVLAAKRHNMYVILDDHGYFTAKIDE
AKARQSQSVPRWSDAGFQEWIRRWVKVAEFFKNEPTVLGYELLNEPHDISPEATRMWYTR
CLKAIRAVDQRHAILVGNSDWSHARAMEKTWGPVATTVDAPYNNVAFTFHDYPDDNHPWE
VAKSITTFRDKYNVPVLCTEFGATHWSKTETVCRMFIAGMLTLFAKEDVGWMIWALKRLE
DNPRGPWTAPKWDSCSYSDFWIPAARITASPTPKAK

Enzyme Prediction     

No EC number prediction in MGYG000004461_02888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	291	540	4.1e-42	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.65e-26	290	536	26	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.12e-06	335	537	121	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT89144.1	6.72e-151	236	573	13	363
SDS60303.1	1.20e-20	296	545	105	342
QEC61327.1	5.03e-20	296	541	102	336
QIK53840.1	9.51e-20	291	545	101	346
AIA99600.1	1.29e-19	291	542	102	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AZR_A	2.01e-12	321	556	65	290	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AMC_A	2.69e-12	321	556	65	290	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	8.65e-12	321	556	65	290	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
3AMG_A	1.55e-11	321	556	65	290	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3NCO_A	9.29e-09	290	515	43	273	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	3.58e-12	296	537	78	338	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P23044	2.30e-09	345	558	114	332	Endoglucanase 1 OS=Robillarda sp. (strain Y-20) OX=72589 GN=eg 1 PE=1 SV=2
P23548	6.50e-06	291	502	80	319	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001129	0.703040	0.295202	0.000214	0.000217	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_02888.