CAZyme Information: MGYG000004461_02350

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_02350
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690	MGYG000004461_20|CGC1	78524.09	10.0754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 9459; End: 11531 Strand: +

Full Sequence      

MKQWNTLFAGAVSAALLLCASAFAAEKQQPTKQWPFDRLPEETLRSMKKKVFAHYFSQFP
ISIDDRDPANDYYQKGYLHPDGENGKHRAYGHFINQRPIPRLPRRVPDWAELDRYDEVRM
AAETGMDGFAYNILSTQGRHWTTLLDLMKQVKKYGKGFSILIMPDMTAEFKGHPERMVPA
LLKIANDPSLFRIDGKLVIAPYNAYAQSPEWWKDRIAELKQNGVDVLFIPGFQGWWKYLK
NYKDLSIGFFDWGTSTLDEQVRWRRKALAETPRYGKFFMAPVRPQDCRPRAGWSGESRGS
ELFREMWKTAMDYDAGMVQLITWSDYSEGSEIAPSTGTRWAFYDLTAYYTSWFKTGKQPK
IVRDAIYYFHRIQSVKAKHDPTKQKKAFRVNGPKAYDEVELLGFLKAPGILRITLNGKTH
EKAFPAGIHKFQIPLEEGRPEFSLVRNGKEIIKLKGNWDISNKITYSNLLYHADGGTAEA
PRTWNGPKKVETKPILGKLIRKIDLPVASEKIRKNVKPVLPSAPLSEPLIGRTAKGNWVL
AGGGKGAVTLAFSDPLPDDSELIFYVNSLKSRPAKGWVAFFLNAGSADGKTRFGLTPRNE
KQTYVSAGWPGTPFKVVRDNFEVEYPAIYRIRRADGKLSLFYGNYPVYTIEESKHGKTDR
ISLYIGTEKPDGAGLLEIGKIELRAVPDKK

Enzyme Prediction     

No EC number prediction in MGYG000004461_02350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	113	453	1.7e-55	0.9493333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11577	GH71	1.21e-46	108	371	23	282	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
pfam03659	Glyco_hydro_71	6.59e-30	108	452	17	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
cd11573	GH99_GH71_like	2.01e-12	110	336	10	255	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11575	GH99_GH71_like_3	5.90e-08	164	339	135	316	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11574	GH99	8.88e-04	148	335	69	308	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT69481.1	4.44e-112	24	481	73	531
QNT70161.1	1.34e-93	5	477	10	508
BBH87369.1	7.33e-91	34	481	49	499
ASY31720.1	1.61e-88	31	472	70	512
QES52163.1	3.43e-88	43	473	6	437

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001307	0.460659	0.537106	0.000400	0.000275	0.000242

TMHMM  Annotations     

start	end
7	25