CAZyme Information: MGYG000004461_00993

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_00993
• CAZy Family: GH167
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976		110831.94	9.7683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 138799; End: 141729 Strand: -

Full Sequence      

MIHHSALFLSILLSGGTLLAESGIVRNGSFEEQTNGNRPSSWHCYNNRGSKAVFSIDDSD
ATAGTKSLKLVNPTPAKPHVTAGIMQNIVLSPGKKYTLSFDARGRNVNGLKIILGKRWKI
NHPVRNIPAKWKHFEFDFTPEEADFSNIGNGSLELHLLTTDICDQLFLDNLRITPAIPPV
IGKKEFQKRKILMIPEIQKEWRTLKSIPQNWSRLFLPETPLFYTGKKVPSGFRAELAFGY
DRNGLIFLADVKDSKVIPGSGSRLWSKDSIQIKISQLGGLQDEVAGDIELSFSPGKDLIH
SWSPQLERPLTSEEAELRGGITQDGYRITAHLNWKLLNRIDRTGKRFFTFNAVVNNVDES
NVRRVAFLAPGLHDTKDNYHNFIAVLESDSPFAAFFPQNPNDPRELSGRVIASGIHADSP
RDLQANVMDSTGKTEKVSIPVLQPITREQVFCSPFRLSLRNLPEGKFTLQWLWNGRPAGK
QEFQKADREKKQKRELENFEKRLETALKTIRGKKLKSRYLTLQTETIRRQLNLQKKIFAD
RKTFLQNPDFYLSKGEIVNRELETVLSALEQELSGDPVYPATYQYAASPVFSYEKGLPVV
DAVTENGEKSKRPMFFTGYGHFGGAVADLPFFQSAGSNLIQLEIGPANVLSGRNPDGTFR
TNPAGFHSFIGKAMKRAMENNHKIALLISPHYLPGWWKNQHPELKTPGSFRTVGEYNIYH
PEHRRMLKAYLEFLIPLIAESPWRDAIHSLVLSNEPEERAKWDDPFLRNLFAEDLRKRFG
TISEFNRNAGTKFASFSELLKTGPEHPAVRYAFYDFRRRAFAEWHAWIARTVKEFFPEVK
VSAKAMDVSMNDRPEDGVDAELFAEFSDYNGNDNYMFYGMGKWISDWQRFSKGHDLQFSM
RPNWIVNSENHIIKDGETRLIPGRSYLYGNLPAVSSGSWRNCHLGLEPGSPEWKTTSFRQ
HLSAPGIHHCTGKGRS

Enzyme Prediction     

No EC number prediction in MGYG000004461_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH167	562	921	4.5e-60	0.48675034867503486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.07e-09	213	377	12	179	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam02018	CBM_4_9	3.98e-09	22	157	1	130	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
cd00241	DOMON_like	6.75e-04	225	364	11	154	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG1874	GanA	0.001	694	940	95	353	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	0.003	668	920	47	319	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43323.1	1.60e-147	24	938	180	1096
AVM46829.1	5.59e-108	11	922	8	911
AVM43886.1	2.53e-73	410	917	213	720
AHF94331.1	9.70e-65	25	916	189	1100
QHW30800.1	8.16e-52	234	922	526	1199

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.999037	0.000165	0.000175	0.000152	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_00993.