CAZyme Information: MGYG000004461_00233

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_00233
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64536.08	5.0075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 292273; End: 293991 Strand: +

Full Sequence      

MVELKDLPPSARVKTEWLDGIGIVEIQGEEPCSGFSAEWRIPQDDIQFRWVADAGKIGIG
YPQFLPPDWFSKTTSQLCCRVPVFSLVGADSGNRLTAAVSESVLPVEFHSGISEYSFQAE
CRIVFPAFSHPFCVQIRLDLRKIPFSSALRDVAAWWEKMAEYSPMPVPESALEPLYSTWY
SYHHEITPEAVEQEAELGLDYGLGTMIVDDGWQKICGAGSYPSAGEWIPSDRFSGLKEHV
RRVQAMGVHYLMWVALPFLGEDSPLFSAMKGKLLYFSKGLRTWVVDPRFPEVRSRLIERC
SQLVESFGLDGLKIDFLDRFPVPSDCVDPAIAEEFAGRDCKSVDEAVFLLLEELCRTLRA
IRPDILIEFRQDYNAPAMRRFANMFRASDCPGDRISNRRRIINLRLLSGNTAVHSDMLGW
CAGESAESAVRQLWNIVFSVPQISVRLAELSPEHRRMLRSWLAFWRENRELFLAGNLTPL
HPELNYPVVMVENASSAAVVVYAENQLVKLCCGKARFLLVNASASEEVLVELAGEELKAE
VFDCFGNFTEQIPLHPGLQKIRIPCSGRLEMH

Enzyme Prediction     

No EC number prediction in MGYG000004461_00233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	165	505	2.8e-32	0.502906976744186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.53e-53	171	467	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.50e-15	172	325	1	160	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	2.59e-07	157	317	272	452	Alpha-galactosidase [Carbohydrate transport and metabolism].
PLN02684	PLN02684	0.003	176	241	206	275	Probable galactinol--sucrose galactosyltransferase
cd14792	GH27	0.003	176	247	5	79	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.50e-143	8	571	21	585
AZN41080.1	5.09e-133	20	567	36	593
QSF42796.1	4.58e-129	36	569	53	586
QTH41069.1	3.85e-128	19	567	32	584
BBI31507.1	1.85e-125	39	567	53	588

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_00233.