CAZyme Information: MGYG000004457_01877

Basic Information

• Species: CAG-485 sp900767075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900767075
• CAZyme ID: MGYG000004457_01877
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		36538.32	5.5178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004457	2747221	MAG	Israel	Asia

• Gene Location: Start: 196; End: 1119 Strand: +

Full Sequence      

MLDDFFGEYKEEARSRFLDHIGGDRWCLKQSVDTQEKVVALFADAPDDEKNNRLRNALLG
IIDDVLFIEDPREKGHYHPRIAAQYTYQFRLLTDYEKWSFNRLYNDFFYHRHNDFWYGKA
MWKLPPLLDATSMLCCAEDLGMIPDCVPSVMHQLEILSLEIQRMPKDPHVEFGDTWHYPY
YSVCTSSTHDMPGIRGWWEQDRNVTNDFYHKVLHEHGEAPVYAEPWICDKIIDLQLQSPS
MLCILPLQDWLSTDANIRRENPMEEVINEPANSRHYWRYRMHLTVEALMLNRAFNESMRN
RIASSHR

Enzyme Prediction     

No EC number prediction in MGYG000004457_01877.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	119	300	1.2e-41	0.3562753036437247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	3.74e-78	2	292	609	903	4-alpha-glucanotransferase
PLN03236	PLN03236	5.45e-64	2	300	422	734	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	2.03e-60	96	284	292	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	1.92e-27	103	296	316	507	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	7.16e-11	137	281	343	474	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34909.1	2.84e-151	2	304	587	889
ASB36857.1	7.84e-148	2	307	587	892
ANU62654.1	7.84e-148	2	307	587	892
QQR10009.1	7.84e-148	2	307	587	892
QCD39232.1	2.15e-144	1	307	586	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	1.16e-07	138	300	496	682	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	2.71e-06	138	300	496	682	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69Q02	2.95e-60	2	307	612	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q8RXD9	8.07e-60	2	307	618	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q9Z8L2	5.27e-11	124	295	345	516	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
Q9PKU9	1.34e-08	124	295	349	520	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
P15977	6.37e-07	138	300	496	682	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004457_01877.