CAZyme Information: MGYG000004443_01111

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae
• CAZyme ID: MGYG000004443_01111
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		43015.93	9.1782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004443	2430140	MAG	Israel	Asia

• Gene Location: Start: 13446; End: 14594 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASNLMRAIKEQDPKADFRFFGGDLMQAEGGTLVKHYREMAFMGFV
SVIANINKVFDNLRRCKADITAYRPDALILIDYPGFNLKIAKFVKTTLGIPIFYYISPKI
WAWKEYRIKSIKKYIDQMLCILPFEVEFYQKHHYPVTYVGNPTVDELSVRPYAEESFDAF
IHQNRLNDKPIIALLAGSRRQEIKANLPEMIKAAAQFPAYQAVVAGAPGIEESFYTPIIH
DTGVSVVFGQTYRLLQQAQAALVTSGTATLETALLKTPQVVCYQIGGGRFTYELFKRILS
VPYISLVNLIANQEVVKELVAHLFSATNMAHELDLLLNDPSTRNKMLEGYNTVQRRLGTP
GAAKRAAAKIIETLRECPPKTQ

Enzyme Prediction     

No EC number prediction in MGYG000004443_01111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	1.1e-118	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.74e-119	1	357	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.11e-109	1	361	2	366	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.49e-81	4	345	2	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.73e-72	5	361	10	373	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.33e-48	1	332	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64292.1	1.43e-173	1	374	1	374
AHF12800.1	1.61e-171	1	375	1	374
BBD46706.1	1.82e-163	1	375	1	375
SCM56036.1	2.77e-163	1	374	1	374
QDO69124.1	2.34e-162	1	376	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.19e-45	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.32e-45	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.25e-74	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	3.62e-71	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	4.75e-68	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	1.36e-67	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	8.09e-66	5	376	11	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004443_01111.