CAZyme Information: MGYG000004431_02404

Basic Information

• Species: COE1 sp001916965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; COE1; COE1 sp001916965
• CAZyme ID: MGYG000004431_02404
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000004431_31|CGC2	36103.74	7.0984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004431	3494954	MAG	Israel	Asia

• Gene Location: Start: 18267; End: 19196 Strand: +

Full Sequence      

MKISVAMATYNGAQYIEEQLESIRIQTMPVDEVRICDDGSSDDTVEVICHYIREHGLESS
WSVEVNQENLGYASNFMKAVGLTNGDYVFFCDQDDIWIADRAERMIGLMEAHPDMLLLGS
EFDSFVSAKDAPSVPGWERKMIRNDESLEKMQFTPANIFIGCQGCTMCMRRQLLERAMPY
WYKGWAHDEFVWKLALCMDGLYMYHSYTLRRRLHSNNVTMRKVRDITKRLKYLTDLQDSH
MATLKYARENGLSKSQLALLEKNIKATRLRIELLRNKKLWNIVPLTLFYRECYHKCRAIP
VELMMAVRN

Enzyme Prediction     

No EC number prediction in MGYG000004431_02404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	171	2.2e-25	0.9588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	1.61e-69	4	219	1	210	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.09e-23	4	174	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.79e-23	5	205	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	2.34e-22	1	291	3	276	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG1216	GT2	4.52e-15	1	176	3	181	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29016.1	1.46e-125	1	309	1	309
ADL35154.1	3.57e-121	1	309	1	308
AAN63686.1	2.66e-79	1	307	1	307
QYH52535.1	4.09e-53	1	297	1	294
QIM47011.1	4.24e-53	4	293	21	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	4.99e-13	2	120	2	124	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
2Z86_A	2.03e-08	3	103	377	473	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.03e-08	3	103	376	472	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39621	2.76e-12	2	120	3	125	Spore coat polysaccharide biosynthesis protein SpsA OS=Bacillus subtilis (strain 168) OX=224308 GN=spsA PE=1 SV=1
Q57287	3.39e-10	3	219	7	222	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
O32268	1.63e-09	3	179	8	172	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
P71054	2.05e-09	2	135	6	142	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
P37783	2.22e-09	7	217	1	209	dTDP-rhamnosyl transferase RfbG OS=Shigella flexneri OX=623 GN=rfbG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004431_02404.