CAZyme Information: MGYG000004420_00215

Basic Information

• Species: RUG841 sp900313795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841; RUG841 sp900313795
• CAZyme ID: MGYG000004420_00215
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22270.15	10.0181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004420	2033021	MAG	Israel	Asia

• Gene Location: Start: 89118; End: 89714 Strand: -

Full Sequence      

MNKKSLLLTVIIVAMTFVFTVMPAMSAQKASMHDIKQYIIKCSTEMGVEPEIALSIAKHE
SGFCQEKRSYMGAVGVFQILPSTARRVGYNPYQYQSNIKGGIAYYKQMKRMFKSDAIALA
AYNAGPGTVKRYGGIPPYAETRRYVKTVMKYYHEYKSNPDGTVAPMLAAVKAPKEDQKVL
AEKEHREMLTLFMLNQAI

Enzyme Prediction     

No EC number prediction in MGYG000004420_00215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	45	157	1e-26	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.63e-32	50	152	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.38e-30	47	156	18	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.36e-28	36	152	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	7.09e-26	55	156	17	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.04e-18	39	142	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	4.05e-47	28	163	22	157
ANR70806.1	5.80e-28	34	153	79	199
ARJ39856.1	6.74e-28	39	154	100	217
QNH53406.1	1.15e-27	34	152	79	198
ABO51021.1	1.79e-27	24	155	78	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.11e-11	36	149	417	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.12e-11	36	149	421	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.13e-11	36	149	427	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.13e-11	36	149	431	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.14e-11	36	149	437	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	9.85e-26	34	153	59	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.65e-23	38	164	1425	1553	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.65e-23	38	164	1425	1553	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC3	4.07e-08	53	155	498	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.07e-08	53	155	498	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009370	0.989254	0.000617	0.000290	0.000225	0.000228

TMHMM  Annotations     

start	end
5	27