CAZyme Information: MGYG000004390_01076

Basic Information

• Species: Prevotella sp002265625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002265625
• CAZyme ID: MGYG000004390_01076
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000004390_15|CGC1	58264.33	6.5706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004390	3321071	MAG	Israel	Asia

• Gene Location: Start: 29976; End: 31538 Strand: +

Full Sequence      

MANRIFKALSLAVMLSASAGISAQTRYTVLPSSPEQHIQHFGASDAWSMQFIGLWPEQQQ
RQVADWLFSSENDEQGKPKGIGLSIWRFNLGAGSAEQGDKAEINSATRTECFLRADGTYD
WTKQEGQRRFLKLAKERGVPYMLAFCNSAPVYFTKNGLATNTGRGGTINLKDDCYDDFAR
FMATSVKGIEEHDGVHIDYISPCNEPDGHWNWLGPKQEGSPATNREVAHVARELGKALSK
QKLNTEILVNESSDYRCMLGTHVADWQRGNEIKALFSKDSTQTYVGNVKHMMPLIGGHSY
WTNTPIDYMRECRMQVREACKKQNIKFWQTEICIMGNDEEIGGGGGYDFSMKTALYVARV
IHHDLCYANAESWSWWRAAGGDYRDGLLRIYSNDGWKTGYAVDSKLLWTLGNYSRFVRPG
AQRFDIRTVSEDGKEITEGFNDPKGVMCSAYRNSDGKWAIVAINYSEDVKPVSFNVEGVS
AKTWRMYRTSDVSAESLAPIGTTDGTTNLAPRSVTTLVEE

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	27	518	2e-181	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.58e-134	21	388	6	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	6.82e-20	4	518	13	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66373.1	1.71e-313	1	520	1	524
QVJ80557.1	3.79e-266	32	520	26	506
AGB29516.1	6.51e-255	14	520	18	524
EFI72737.1	6.20e-251	24	520	20	516
BCS84535.1	1.50e-249	13	518	10	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.28e-96	36	490	17	468	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	1.25e-16	23	518	1	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	7.92e-16	23	518	8	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	9.30e-15	7	518	5	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
6IUJ_A	3.67e-11	8	495	12	453	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	1.03e-16	11	518	5	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002907	0.994486	0.001837	0.000301	0.000234	0.000206

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004390_01076.