CAZyme Information: MGYG000004371_01065

Basic Information

• Species: Prevotella sp002251385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251385
• CAZyme ID: MGYG000004371_01065
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000004371_21|CGC1	37873.8	4.6716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004371	2690194	MAG	Israel	Asia

• Gene Location: Start: 10208; End: 11233 Strand: +

Full Sequence      

MKNIFKMLLVSVVAFMFAACDTDVETKNPVNLTDPARTPEYYEALRAYKKSDHPVAFGWF
GNWVGAGASLENSLRGLPDSVDFVSIWGNWRNLTPERKADLEYAQTVKGTRALVCFIVQN
VGDQLTPEGEDATTFWGEGDEAIVKYANAICDTIDKYGYDGFDYDYEPNYGHRGNISGVP
AAEKVFVEALSRRLGPKSGTDKMLVIDGEPQTINSELGPCFNYFIVQAYQCTGDANLDGR
LQGTIMNFNGVLEPEEVAKKYIVTENFENFALAGGVSFTDRNGNEMMSLEGMARWQPIIN
GKKVQKGGIGTYHMEYEYMAGKQPSYPALRKGIQIMNPAIK

Enzyme Prediction     

No EC number prediction in MGYG000004371_01065.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	1.23e-100	22	335	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	2.04e-69	54	318	1	242	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR11088.1	1.94e-155	1	341	1	378
QUT81795.1	4.81e-155	19	341	20	354
QRQ56874.1	4.81e-155	19	341	20	354
ALJ45245.1	4.81e-155	19	341	20	354
SCV09578.1	4.81e-155	19	341	20	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	2.30e-71	24	337	43	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	9.76e-18	48	338	24	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	1.17e-16	48	338	24	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	1.63e-17	45	338	52	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004371_01065.