CAZyme Information: MGYG000004370_00826

Basic Information

• Species: CAG-484 sp900321895
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484; CAG-484 sp900321895
• CAZyme ID: MGYG000004370_00826
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42317.73	9.7612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004370	1784002	MAG	Israel	Asia

• Gene Location: Start: 44806; End: 45930 Strand: +

Full Sequence      

MKKVFIVTGEYSGDIHAAKVAEALKNSDPSIIIEGVGGKNLKAAGVKLLENQNKMGAVGL
SPQIIFNHYFLGKKIVDYLTKDFKPDLVLLIDYGAFNLSIAKFLKKAGIKVFYYIPPQVW
ASRKWRIKTIKKYIDEVLCIFPFEVEMYKQYGINVHYCGHPLVSQLPQPANRDEFFLKHG
LDPNKKLVSVFPGSRAFELKYLMNVFLKTAKNLQKKHPDLQICISHAPNLSDELYSKYLK
DTDFKVIKGENQALLSVSDALILASGTVALEAALYSTPMIIAYRGPYLFYLIYLLVRCIK
MVSLPNIVSGEKIVPEIIENQVTVDNITYSIEKILYDRGYRENNIKKLKQVKHLLSDKTS
SKEAANEILKALQS

Enzyme Prediction     

No EC number prediction in MGYG000004370_00826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	5.2e-107	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.66e-116	1	374	1	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.93e-101	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.46e-77	4	371	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.59e-70	4	327	8	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.84e-49	1	370	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.76e-198	1	372	1	372
QSV45574.1	2.34e-75	2	365	7	373
QTS83715.1	4.40e-75	2	372	6	376
AKQ33376.1	5.54e-75	2	374	6	378
AEG01383.1	1.94e-73	4	373	10	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.71e-45	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.19e-45	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	5.08e-72	2	372	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	7.94e-71	3	372	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B6J161	7.78e-69	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	1.10e-68	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.10e-68	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004370_00826.