CAZyme Information: MGYG000004369_02578

Basic Information

• Species: CAG-882 sp000435595
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp000435595
• CAZyme ID: MGYG000004369_02578
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000004369_55|CGC1	76822.39	5.3895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004369	3090795	MAG	Israel	Asia

• Gene Location: Start: 11274; End: 13280 Strand: -

Full Sequence      

MIYGVDYYPEHWDRSEWEHQAELMKEGGFNTVRMGEFDWKLFEKEEGKFDFSILDDAVEV
LASKGIKVILGTPTAAPPKWLADRYDVLQRDRYGRVRAWGSRRECCANSRDYIEKSAVIV
KKMVKHFAGNRNVIGWQIDNEFGCHASTRCYCENCRRAFAKWLKKRYEDIDSLNKTWGNV
FWSLDYDSFEDVILPAYNSCEGENYPNFAHNPSLDLEYRRFASDSWVKYQRMQVDIIRKY
SDLPITHNFMGHFSDIDYYKLGRDLDYVAWDNYPDNQWGGSEYQYVSMAHENMRGIKNKN
FIVMEEQAGPCGWDVVGRTPEPGQLRLWAYQAIAHGCEGLVYFRFRTALFGMEQYWYGVL
DHDGIPRRRFYEIKQTGEELKKLEEHIAGVSGDYEALIYKSYDDVWSHEIKRHKAGFDYR
DLLYAYYKANSDLNVTAAVSDSDFSKYKVVYMPAHNVVTGREIKKLEEYVENGGTLVLTY
RSGTRDYYNNMRATTVPGAFAKLAGIEVSEFSTPDGRVKLEGDIFADGCGIAADEDSATG
RLWCDIIEPKGAKVLACYAEDYYKGKAAITVNEYGRGKVYYAGCDMDGNTLKTFVKYISE
GCGITTSELPEGVELVKRADGCMFLLNHNRTACETEITGTNMLTGEVFDGRIEGYGAYCI
KKHIDEKV

Enzyme Prediction     

No EC number prediction in MGYG000004369_02578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	6	382	2.8e-142	0.9973045822102425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	7.21e-160	6	383	1	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	1.16e-132	1	651	16	659	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	1.01e-46	396	598	4	200	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	3.31e-19	396	511	2	120	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam01301	Glyco_hydro_35	1.46e-09	14	209	23	215	Glycosyl hydrolases family 35.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG98277.1	1.82e-230	1	652	1	661
ANE47075.1	2.45e-224	1	656	1	664
QGQ95545.1	1.00e-185	1	656	1	657
AZN39823.1	5.19e-184	1	639	1	638
AGB41273.1	9.43e-173	1	640	1	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	3.20e-133	1	615	1	625	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	1.65e-116	4	645	3	630	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
3TTS_A	1.89e-116	3	651	11	661	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
6Y2K_A	4.27e-110	1	647	1	643	ChainA, beta-galactosidase [Marinomonas sp. ef1]
5E9A_A	2.37e-89	1	629	39	671	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94804	2.76e-134	1	656	1	659	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
B9LW38	1.75e-132	1	615	1	625	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
D9SM34	1.59e-128	1	656	1	651	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
D5JGG0	1.67e-122	1	640	8	636	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1
Q8GEA9	4.17e-117	4	634	3	618	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004369_02578.