CAZyme Information: MGYG000004348_00552

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004348_00552
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1258	MGYG000004348_2|CGC3	141944.74	5.4175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004348	1551350	MAG	Israel	Asia

• Gene Location: Start: 206560; End: 210336 Strand: -

Full Sequence      

MKGTIDCFLPCGDFAAIANTLRQLRGSRMIRHINLMVTSDFALANAVPDGCSFVVVDGLH
SSSAIRSMAENVTADYAMMFLGYAPVSLGQYAIQRMMRVAMETGAAMVYSDRLAVKNGTA
EPHPVIDWQEGSLRDDFDFGSMVMADASLLRKFAEETDDTDYKYAGWYELWLYLSRHGRM
FHINETLYTEEETDLRASGVKQFDYVNPANRAVQIEMEQAVTAHLKAVGAWVDTSAYTEP
DFDEQEFDVEATVVIPVRNREKTICDAVDSALSQVTKFKFNVIVVDNHSTDNTTKLLDAY
TDERLIHIIPQRTDLGIGGCWNVAVDDKRCGRFAVQLDSDDLYSSPGTLQSIVDAFYSQR
AAMIVGSYRMCDFGLNTLPPGLISHAEWTEANGCNNALRINGLGAPRAFFTPLLRQIRFP
NTSYGEDYALGLAFSRHFKIGRIFTELYLCRRWDGNSDAALSVDKVNANNLYKDRLRTME
LMARKKMNSGGAPMFENNSLGRFFNRQMETWDLARRNFRNLQDVMTRKIDIDGTMALLQY
NPARIVSTGATISKKAIEERPCFLCPDNRPNEQEAKRFGDRFEVLVNPYPILPVHFTVAS
RKHEPQRITETYHEMQRFLARFPRMMVFYNGPECGASAPDHLHFQAGSTEVLPLLTSWPR
LQRGLVTLCSINEGNEISVLPDWICPAIVIRSKSAECGEAMFKRVYDALPVNEGQPEPMM
NIIGWMAAGQCVTVVFPRGKHRPDCYYADGDGKTLVSPGALDMGGLIITPRKCDFDSITP
DTAYAILHEVSLPEAKLRQAIDKIRENPTHDENGEKPAKEQNEPCVQVGIISAHDINFTL
NGEYMAKGEIITGQQHVSFAEGGISWNGNLYRELTFSPHGMDESFSLENVTIGVNFHWQR
QETQTFKGMLRLVVEADKVCAINCLPVEDYLTSVISSEMKATSSLEFLKAHAVISRSWLL
AQMERRRRQDTGGSGFFSFVKKDDELIRWYDRDDHTIFDVCADDHCQRYQGITKANNVHV
EQAVKETRGQILMYGNDICDARFSKCCGGATEEFQYCWENKPQPYLISLRDNGDGKQPLP
DLTNEAEADKWIRTSPDSYCNTDDKKILSQVLNDYDQDTSDFYRWHVEYTQEQLSGLISD
KLKMDFGDIIDLVPVERGRSGRICKLRIVGSKRSFTIGKELEIRRALSETHLYSSAFVVD
KLDVNNGVPSRFVITGAGWGHGVGLCQIGAAVMGERGYSYDEILLHYYRGAEIREIYN

Enzyme Prediction     

No EC number prediction in MGYG000004348_00552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	252	382	3.6e-17	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	1.77e-98	612	798	2	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.33e-52	921	1253	2	265	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	5.30e-44	861	1256	89	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	1.26e-37	921	1256	68	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	1.16e-28	915	1033	1	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80566.1	0.0	1	1258	1	1224
ADE82754.1	0.0	1	1258	1	1224
BCS84357.1	0.0	1	1257	1	1252
QNT65264.1	0.0	1	1257	1	1259
QYR11045.1	0.0	5	1257	4	1245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	1.53e-12	910	1254	51	318	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	4.91e-11	925	1257	64	330	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	5.92e-11	925	1257	88	354	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	8.58e-14	906	1253	88	351	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
Q02113	3.46e-12	931	1253	422	702	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
P13251	9.50e-10	921	1255	72	332	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1
P07372	2.97e-09	879	1255	28	331	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004348_00552.