CAZyme Information: MGYG000004347_00697

Basic Information

• Species: UBA5884 sp900551505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA5884; UBA5884 sp900551505
• CAZyme ID: MGYG000004347_00697
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		71295.46	3.9097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004347	1790191	MAG	Israel	Asia

• Gene Location: Start: 5245; End: 7188 Strand: +

Full Sequence      

MKNFSWKKLTSAVMALAITASALAVAPVYAADSTKYELENGELTGAEVATDETGYSGSGY
VYLKDAGQKISVKVTVPETGMYKVKFGYNLPKSSGSKVQNIYINDVSQGSVSFKPTEGFD
EISGGLMRFIEGENTFTIESYWGWTMLDYITVEPASLPSLDSASNTPCDPQATDATKRLM
SYLGDVYGNGIISGQQEIYGGGPDTEFDYIQNTTGKLPAIRGFDFMNYNPLYGWEDNTTS
RIIEWTNEKGGIATASWHINVPVSMDGYKVGDKVDWSKCTYSQKTDFVTANILVDGTVEQ
EYFNSAVDMLAEQLKKLDEADVPLIFRPFHEAEGAGGEDGAGAWFWWSKEGADVYKKLWK
LLYTKLTDEYGLHNLIWEFNSYTYASSAAWYPGDEYVDIVGYDKYNANDGKPNESAISGV
FYNIADIIGGKKMIAMAENDTIPTLENIQEEKANWLYFCPWYGDFITSSSYNDPAKLKEM
YNSDYCITLDELPDLKSYPLPDENPDTAETTVTTAETSDTTETSDTTETTVTTDVTSDTE
ETSDTTETTDVTSDTTETTDVTSDTTETSDTTETTVTTEDTTTTTVEGDYKKGDVNHDGS
VNVMDLMALAKYIVGQTTEINPEADMNGDGKYNVMDLMEIAKIIVGA

Enzyme Prediction     

No EC number prediction in MGYG000004347_00697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	169	491	1.2e-102	0.9933993399339934
CBM35	36	152	2.8e-28	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.59e-50	169	491	2	311	Glycosyl hydrolase family 26.
cd04086	CBM35_mannanase-like	3.00e-38	34	153	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam16990	CBM_35	1.74e-16	36	154	2	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd14256	Dockerin_I	2.30e-13	592	645	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd04083	CBM35_Lmo2446-like	1.88e-12	34	120	1	88	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDE29814.1	7.88e-178	6	509	5	531
ERJ92224.1	9.14e-173	1	493	6	520
QKS45740.1	1.45e-170	1	521	1	538
AIQ53393.1	3.48e-169	1	501	1	518
ASR49482.1	4.51e-169	1	497	1	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	9.28e-82	36	492	15	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.06e-51	164	492	3	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6D2X_A	2.01e-48	169	492	6	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	5.43e-47	103	492	28	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	1.35e-39	164	493	31	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.99e-77	33	492	41	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55297	1.15e-69	36	493	24	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	2.96e-69	36	493	23	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P49425	3.27e-68	31	500	14	465	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	2.47e-67	36	493	24	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.998997	0.000192	0.000199	0.000175	0.000150

TMHMM  Annotations     

start	end
9	31