CAZyme Information: MGYG000004345_00430

Basic Information

• Species: Streptococcus thermophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus thermophilus
• CAZyme ID: MGYG000004345_00430
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000004345_4|CGC1	24594.01	9.71

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004345	1760385	MAG	Israel	Asia

• Gene Location: Start: 18127; End: 18783 Strand: -

Full Sequence      

MPKGKKKTKSKARPKKSKKKKKSVLLFPKFFQKWSLIFIGLFSLLGLLASLNFPRLTMEK
NMTPTDETTVAFIAEIGETSRYLAARNDLYASVMIAQAILESDSGQSQLSQKPLYNFFGI
KGEYNGQSVTLPTWEDDGKGNPYHIDAAFRSYGSVENSLQDYVEFLEGSYYVGVHRSKTR
SYKDATAALTGVYATDTTYGDKLNSIIEQYQLTIYDTY

Enzyme Prediction     

No EC number prediction in MGYG000004345_00430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	83	212	8.9e-30	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.59e-63	32	217	5	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.13e-61	67	216	318	472	amidase domain-containing protein.
PRK06347	PRK06347	1.74e-57	58	217	139	304	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	1.59e-29	69	216	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.42e-22	83	212	7	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKB97115.1	9.67e-142	1	218	1	218
ABJ65811.1	9.67e-142	1	218	1	218
CAD0166935.1	9.67e-142	1	218	1	218
QYK21785.1	9.67e-142	1	218	1	218
QHD70953.1	9.67e-142	1	218	1	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.49e-40	63	216	26	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.04e-34	69	216	60	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.45e-11	72	209	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.48e-11	91	207	23	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.74e-11	91	207	24	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.23e-34	62	217	174	334	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.90e-34	58	217	47	215	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	1.43e-33	69	216	320	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P0C2T5	1.42e-32	28	216	20	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.74e-31	72	216	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999961	0.000055	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	53