CAZyme Information: MGYG000004340_01217

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000004340_01217
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000004340_50|CGC1	26603.41	6.8663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004340	2211293	MAG	Israel	Asia

• Gene Location: Start: 4152; End: 4877 Strand: -

Full Sequence      

MLGRFVKRLAAWLLAAAIFVLVVIGGLLGVQGWQLYRTTIAARPITGLYDEIAARPGFAS
CDQLPQTYIDAVIAVEDSRFEKHHGIDPAAIVRALWTDLRTHSMAEGGSTLTQQLAKNEL
FTQEKRMSRKAAEIFAARDLEDYYSKQQIFEMYAGSSYFGNQWYGVAQAAEGYFGKTTAE
LTDAECAVLAGLPNAPSVYAANGELARKRALVVADRLESTGKRTHIQTLQLKDEINALPL
W

Enzyme Prediction     

No EC number prediction in MGYG000004340_01217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	59	217	3.8e-54	0.903954802259887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.36e-67	43	218	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.96e-60	58	224	4	172	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.83e-54	38	222	56	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.63e-50	58	221	69	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.57e-39	62	234	72	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP00668.1	8.76e-138	1	241	1	241
QIA43609.1	8.76e-138	1	241	1	241
ATL90873.1	2.51e-137	1	241	1	241
QYX26381.1	5.49e-57	18	232	15	236
QUO38940.1	3.86e-55	4	221	2	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	5.21e-33	48	236	11	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.05e-32	48	236	11	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	2.44e-32	64	197	48	181	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	1.51e-27	64	199	47	182	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	6.44e-27	51	238	52	244	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KNU5	5.28e-32	62	217	72	229	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
P31776	1.34e-31	64	197	63	196	Penicillin-binding protein 1A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcA PE=1 SV=2
P02918	2.48e-31	62	237	72	250	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
P39793	4.68e-31	36	221	75	263	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
P38050	7.68e-31	60	199	71	210	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000027	0.000012	0.000000	0.000000	0.000028

TMHMM  Annotations     

start	end
13	35