CAZyme Information: MGYG000004329_00930

Basic Information

• Species: Prevotellamassilia sp900539625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900539625
• CAZyme ID: MGYG000004329_00930
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1211	MGYG000004329_14|CGC1	134693.08	5.1658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004329	2571737	MAG	Israel	Asia

• Gene Location: Start: 2336; End: 5971 Strand: +

Full Sequence      

MISNTKLLQIVAAFLLFIGLADIKATAQVVENPKEVCDLLNRIGGEGTAERIATTIDPSV
ASAGREAFVLTSQDGKPCIKGSNVSALTTGINWYLNHYAHVNIAWNNLTTDLSQVEFPVP
TKQEKHSTTVGYRYYLNYCTFSYSMSTWTWERWQKEIDWMALHGINMPLQIVGLDVVWQK
LLTQDLGYTDDEANAFIAGPCFQAWWGMNNLQGWGGKNPAWWYKRQEALAKKILAREREL
GMEPVLPGYAGMVPSDIAKKGYSANNQGNWCGFLRPYILDPNTEAFAEISAKYYARLAEV
MGTSAYYSMDPFHEGANTSGIDVASAYKRIGEAMFKANGKAKWVIQFWQWSQAQYNVLSQ
VSKGKLIVLDLFSDAHTHFGEYNGHDAVYCILPNFGGRTGLFGRLSKVMKDFYAQKSLNT
NVKGVGATPEAIEQVPVLYDALFELPWRTSAPSPQAWLKDYTLARYGTSNTAAQKAWELV
RNSALNCETSLQGPHEAVFCARPSLTVDRVSSWGGTGIFYDTQMMVGAAHNLLAAQLSGT
NYSYDLTDFSRQALTDYGHQLLASINEAAKSPNEAEAYAKRRDAYLQLMLDLDELLSTNE
NFMLGRWTNMARGIADEAEGTTEADRQWLELNNARTLISTWGDENSSEGSGLRDYSYREW
AGMMKDFYYPRWQAFFNSRDNGKVLPNWFANDWKWAHNASLSYSDQPTGNTTEVAARLLG
KYFATLQKTDGTPYYIYRYLATDATSTLVFSALRGETFTLPLATPTDGTTLSFGIDLDND
GTIADNEMTETTAMNIPATAACGKAKAMLKFNDGTQLLFTIILKDNITEARSVTVQTADA
KQGRVQISGTTKLTVTNAKEVTMRATPANGCEFLNWTDESGRVVSTENPYTYYGAAPQTF
TAHFFADKWGMPQENMADYNDMKSFGQFLRSIAVAQNGGEEKNVYAATDCPESLCQTTQT
VKAPQGSRFKLHWLSSGGLNYCRLSAYIDLNADGDFEDEGEVLEVYGKKESPANDALNDY
VLTVTLPYDLPLGITRIRLRFDSSWASGWDSKTDGMPAKSETKRMVYDIPVLVTDKSSEA
CTVTVKSADMKQGTADANGQPDTYTYRAGEEIVLRAYPADGYAVDHWTDTYGRRVPQTWS
DGNFLRFYAPESGTYTVVFKPATTDGISAVENSAAKAAYVYDLLGHKFADGSFQHLPSRI
YIANKEKRMGK

Enzyme Prediction     

No EC number prediction in MGYG000004329_00930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	719	1.2e-194	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	2.68e-156	133	449	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	3.96e-75	457	715	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.86e-15	38	120	5	79	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
pfam18998	Flg_new_2	0.005	833	904	1	70	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	8.79e-235	26	727	16	722
QMW86693.1	4.80e-187	1	715	7	733
AAO79464.1	4.80e-187	1	715	7	733
ALJ43270.1	5.23e-187	15	715	8	725
BCA48901.1	8.06e-187	42	715	4	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	5.10e-116	35	713	173	864	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.13e-116	35	713	181	872	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.09e-115	35	713	196	887	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	3.89e-94	39	723	12	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	5.01e-93	39	723	35	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	2.37e-90	61	723	73	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999199	0.000147	0.000161	0.000141	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004329_00930.