CAZyme Information: MGYG000004329_00340

Basic Information

• Species: Prevotellamassilia sp900539625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900539625
• CAZyme ID: MGYG000004329_00340
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000004329_3|CGC1	60827.62	8.0282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004329	2571737	MAG	Israel	Asia

• Gene Location: Start: 111356; End: 113005 Strand: +

Full Sequence      

MKFNKIVALAFAAVLGFGAQTANAQSLSPSTKWHWDKGTIVVETPARPAGQKNVLGLKLP
KYKTVRIGLVGLGMRGPGAVDNFCVLPGVEIVALCDFVEARAVAQNEKLRKRGLPPAAIY
SGENGYKELCARPDIDLVYIATDWAHHFPVAECALKHGKNVADEVPSAMNLEECWKLVDL
SEKMQKNCMILENCCYDWFEMRTLNMAQHGVFGEILRAQGAYIHNLDDFWDYYWKNPDGS
DPEQLGWRLKYNRENRGDVYATHGLGPVAQALDIHRGDRMTTLVAMDTKSVHGKELVEKK
TGKPCNDFRNGDHTTTLIRTANHKVIELQHDVMNPQPYSRLYQLTGTKGFANKYPVEGYA
VDASQLKNAGHQPQVDNLSSHSFMPEAEKAALEKQYEHPILAKFGKLAKEVGGHGGMDFI
MCARLIYCLQHGLPLDMDVYDLAEWCCIAELGALSMDNNCASVTFPDFTRGHWNDVKGYK
HKYASAEEEAAVEASSKAWTAAWKAAGAKNNLWKLFDAMTKADAKNKAKATKAYAKALAK
TRAAAAKAL

Enzyme Prediction     

No EC number prediction in MGYG000004329_00340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	474	2.3e-150	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.37e-19	63	362	2	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.71e-12	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	0.001	64	183	4	113	putative oxidoreductase; Provisional
COG4091	COG4091	0.001	63	172	16	135	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13386.1	1.32e-296	1	525	1	521
QCQ31109.1	4.83e-282	4	509	6	509
QRO24012.1	2.56e-276	31	509	34	509
QPH58140.1	8.82e-274	19	509	20	507
QBJ17807.1	3.58e-273	19	509	20	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	8.43e-84	47	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	4.15e-64	63	477	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3EC7_A	7.88e-09	64	224	23	178	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E82_A	4.47e-08	64	222	7	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	5.26e-271	20	509	23	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	1.49e-262	1	509	1	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	2.54e-252	24	532	21	527	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q7MWF4	2.87e-190	26	484	14	467	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	4.53e-190	42	484	38	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998984	0.000180	0.000210	0.000184	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004329_00340.