CAZyme Information: MGYG000004321_00678

Basic Information

• Species: Streptococcus constellatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus constellatus
• CAZyme ID: MGYG000004321_00678
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000004321_5|CGC1	42195.63	10.1983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004321	1789116	MAG	Israel	Asia

• Gene Location: Start: 8364; End: 9467 Strand: +

Full Sequence      

MKRTNLRYVWLVGILLTLTAIFTYVRINSTGHLKSQISQQWLKGYVVRQKDQAYVKTTNN
KKKDVVLSESQGYGMVIAVEAAKQRNASLKDFERLYNYYLAHRIKNTQLMSWRQTVKNGI
VKAETNNATDGDLYIAYALIQAAKLWPQKAAVYNAQAKAILKDILTYNYNSTTGVLTVGN
WATSDSKYYRLMRTSDVLPAQFQAFYKLTGNRQWLNIRSNMLSKLEMMSAKTKTGLLPDF
LWVEANTVRAVEKKSVASKYDGDYYYNACRLPYNLAQSQDKQSQKILDKMMNFFMKQEIL
YAGYTLKGKALNNYQSASFGAPIFYAANRNSAYRKLVQQNKYIFMQDLSKENYYEAAMIT
LVALDAL

Enzyme Prediction     

No EC number prediction in MGYG000004321_00678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	39	363	1e-66	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	2.61e-23	39	364	9	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.02e-17	51	367	39	344	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.74e-08	68	270	54	248	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL42709.1	2.53e-264	1	367	1	367
VEE83412.1	7.25e-264	1	367	1	367
ALL03661.1	3.77e-234	1	367	1	367
AGU82194.1	3.77e-234	1	367	1	367
BAN61023.1	7.61e-234	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	7.79e-32	53	355	72	391	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	6.78e-25	68	337	73	350	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	7.62e-25	68	337	79	356	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.23e-11	68	276	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	6.19e-08	68	272	48	242	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.62e-31	53	355	72	391	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.97e-23	68	354	129	421	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	3.47e-08	68	272	56	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P18336	2.08e-07	68	272	52	245	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P27032	7.99e-07	55	275	41	248	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998247	0.000747	0.000205	0.000004	0.000003	0.000812

TMHMM  Annotations     

start	end
5	27