CAZyme Information: MGYG000004317_01736

Basic Information

• Species: Lachnospira sp900316325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900316325
• CAZyme ID: MGYG000004317_01736
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000004317_21|CGC1	49598.65	5.6877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004317	2482422	MAG	Israel	Asia

• Gene Location: Start: 27296; End: 28600 Strand: -

Full Sequence      

MGFSKFFLNAGEALRPVLTKIIPMKLLSKMKAGIINNATDKLSADSIAKYEPVKYKQGVN
VIGNIKGDNGLGQSARIMCRLLDENNEAHVIRDFFVPPGGSRTNETYDDRLTTELPYDIN
VIHVNASEFMVAYLSLGKEVWDYRYNIGYWAWELETFPEEWLPAFKLVDEVWTPSDFVTN
TLKKYTDKPVITVPHCIAPVTDEKYDRKHFNLPEDKFLFLVMFNSGSVMERKNPLAAIKA
FKESFCKDEKTKKKYKDVGLVIKISEAELSTDDEKIINSVVDKDDNIYYMCGHLNKTEVN
SLIADVDVYVSLHRSEGFGLVMAEAMYVGTPVIATNWSGNTEFMNSDTACMVGYDMKELD
KDYEPFKKGNLWADAHVDEAAQFMKKLYEDKEFYNKIAVNGQNYAKEHLAYKRSADIVSD
RIRKIHGVFDKEVH

Enzyme Prediction     

No EC number prediction in MGYG000004317_01736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	226	396	3.9e-17	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	6.79e-26	118	423	82	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.55e-23	119	427	102	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd01635	Glycosyltransferase_GTB-type	3.04e-14	172	343	63	225	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03809	GT4_MtfB-like	4.34e-14	166	406	137	349	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03817	GT4_UGDG-like	6.86e-14	168	417	148	368	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71127.1	4.35e-282	1	427	1	428
BBI36185.1	7.15e-98	15	433	17	432
QQZ62154.1	1.36e-97	14	425	19	422
AOZ93295.1	1.09e-94	11	425	20	428
ANY70499.1	8.57e-93	5	407	12	406

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004317_01736.